SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI71622 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI71622
Domain Number 1 Region: 87-163
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.84e-26
Family Skp1 dimerisation domain-like 0.0000902
Further Details:      
 
Domain Number 2 Region: 7-69
Classification Level Classification E-value
Superfamily POZ domain 1.39e-16
Family BTB/POZ domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI71622
Sequence length 166
Comment (Phytophthora ramorum)
Sequence
MAPHETKVKLVSMDGEAFEVDASVAVMSQLVQTLVADEGDEVQEIPLPNVKAHVLAKVVE
FCQHHKDAPMAEIQKPLKSNVLSDSVDEWDATFVDVGENQELLFELILAANYMDIKSLLD
LSCAKVATMIKGKSPEEIRATFGITEEFTEEEQQRILEENKWCEDV
Download sequence
Identical sequences H3G9E6
jgi|Phyra1_1|71622|fgenesh1_pm.C_scaffold_32000004 164328.JGI71622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]