SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI71773 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI71773
Domain Number 1 Region: 15-205
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.43e-53
Family Pectate lyase-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI71773
Sequence length 231
Comment (Phytophthora ramorum)
Sequence
MPDGSWPASKGTVYYKEPYTVKKGQTFDGGMKTYARSNVKCGGQKESGWQTAVFMVEPGA
TLKNVIIGKDQMEGVHCEQSGCTIQNVWWEDVCEDALSIKGGSASSVTKVIGGGARSADD
KVIQHNGLGSVSIEGFYAQDFGKLYRSCGTCGGKARKVSLKNVYAVNGKVSLVTVNKNWG
DQATLENIKIKGKKVDVCAWSQGSTSGEPKKLGAGPSGSLCQYSTNTVSYA
Download sequence
Identical sequences H3G9Q0
jgi|Phyra1_1|71773|fgenesh1_pm.C_scaffold_46000007 164328.JGI71773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]