SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI71834 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI71834
Domain Number 1 Region: 79-171
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.52e-24
Family Cold shock DNA-binding domain-like 0.0000535
Further Details:      
 
Domain Number 2 Region: 173-285
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 3 Region: 29-78
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000314
Family ECR1 N-terminal domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI71834
Sequence length 290
Comment (Phytophthora ramorum)
Sequence
MVMEVRVRRLSASMEDDPAELADESQIVVVTPGQIISTETGAFLRGHGTYLSGRNELVAS
VAGVVEKVNQLITVRPLVSRYIGEVGDIVVGRVTDVASKRWKVDVNGQQDAGLMLSSVTL
PGGAQRRRTYADQLQMRAFFVENDLISAEIQEVRYDGSLSLHTRSLRYGKLENGQFVAVA
APLVKRMKQHMVTLPGIGVDAILGTNGYIWVSRSMAALGGDDEDANSSMETRVEVLTAKR
QLHASTPMSVEDRRRIARVSQALLRLNEQFRLITPESIMDTYELLESQGR
Download sequence
Identical sequences H3G9T8
jgi|Phyra1_1|71834|fgenesh1_pm.C_scaffold_53000001 164328.JGI71834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]