SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI72080 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI72080
Domain Number 1 Region: 20-240
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.14e-65
Family Xylanase/endoglucanase 11/12 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI72080
Sequence length 242
Comment (Phytophthora ramorum)
Sequence
MKLSLAAIALATAASTANAQEFCGRNDLKVVGDYTVYNNLWGEDNDPKGNQCTTVDSTTS
GSDIAWHTSFNWAGDNWQVKSYANAALKFDPVQISNVASIPTTMEYTYKYDGNIITNVAY
DLFTSATAGGDVQYELMVWLAALGGAWPLTSTGQPIKSVTLGGVAFNLYQGWNNKTKVFT
YVAKQTTNTFTADLRDFFTELPADNTIETTQYLTHVQAGTEPFQGQNATMTVTKYSAAVK
TN
Download sequence
Identical sequences Q30BY8
164328.JGI72080 jgi|Phyra1_1|72080|fgenesh1_pm.C_scaffold_83000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]