SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI73227 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI73227
Domain Number 1 Region: 394-461
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000295
Family Ankyrin repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 610-708
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000026
Family Calponin-homology domain, CH-domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI73227
Sequence length 802
Comment (Phytophthora ramorum)
Sequence
MTSKKPTQTYGRIALSDLTRDQTSQWSVRAVAGISRQFERPQPQNDASTDSATALRLQTA
TLDKLMSVGLRCGACDVTAFASLDEQYAHFKSAAHCVNLKRRARGLPCLSEEDALQYLET
HSQEKKGRTNKDGGYSSSSSSSSWEEEEEQEKLPTTTEPVVEFSDGKSVFKVFKNILPDA
EEESFNPYTSLEQICASKFRWAVLLLRSGRFAGAVFEKDKALCHKTFQRYTTRRKQGGAQ
SASDASGKAKSAGATLRRYNEAALKQDVAALLVEWKGVLKDTELIFLSSGKTERATFFPE
KNTVLQSDDKRLKRIPFATFRPTFEEVCRVRSDLSSVRFSPLEAAASSPVESTKKAKKKK
KSGEPAPGPEVKEDTPKEDEVKEGEEVPQIIQLVNSGDLKSVKEFLSNADEKDVEVNEVD
AKFMTALHHAAAKNEVPIVEYLLEQGANPALLDLHNRPPYFLCDTKEARNAFRRYMAEHP
GAWDYAIAQIPEGLTSEMEQRKKEKEAEKRRRARERKKQQKREAVEQKREEEARQEELER
KIAAGLACDFCGKYAGKSPFTRLEFKYCSTDCVNGHKRKLMSEAALRRLVLWDRRKAGNT
MMDLPLDDETLQRVYAWIDEIPLSRPKKSIARDFSDGILTAEVVAFYFPKLVQMHNYSAA
NSIKQKQYNWNTLNRKVFKKLHISLSKEDIDDLVQCQPGAIEHLLVKLQLKDPIDVGGFM
ESPAAPVHPMDSIGKSYTPGTEASAKSELRQELAEKDSVIAELRETAQILEMKVQKLEQL
VRLKDGKIQTLVAKLRSQKPQA
Download sequence
Identical sequences H3GCM0
jgi|Phyra1_1|73227|fgenesh1_pg.C_scaffold_2000292 164328.JGI73227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]