SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI73325 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI73325
Domain Number 1 Region: 31-258
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.36e-36
Family Lectin leg-like 0.001
Further Details:      
 
Weak hits

Sequence:  164328.JGI73325
Domain Number - Region: 296-376
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00536
Family Apolipoprotein A-I 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI73325
Sequence length 416
Comment (Phytophthora ramorum)
Sequence
MKTRGLLLLLLCACMALLSCPATAAKMDDVSFKPPFEVVDTEGRRMVNTTWSHGGNADVK
KHFIRLTTDRQSKRGHLWQKSPVGRDELSAILTFRVSGQGKRWFGDGIGFWITGQKVFTP
GVNHGFTDKYKGIGVVIDTFNNPEHKGGHKDVSVFVNDGTKTYDQMYHDKRAGCNAAVRY
HEQSANFDPVHSISRIKVKIDKTRLVVEVDEHASGLWVACHEMTLPFSEDWLRESTIGIT
ASTGALADNHDIIRFDAYTDFTDATTGAVDSEMVMNSVSKDYKKWMDSPNCGTDCLIAVL
QKELSNFRIDAEHRFSDLKEKTENTVAKLKKQEGENERRVREIEAKVRKGIDSSLENTKK
VLGDEVNEKITKQLEENPDIASGGWKTPFALLFIGLAAGAVYLYRKYQSLMKSHLL
Download sequence
Identical sequences H3GCT9
164328.JGI73325 jgi|Phyra1_1|73325|fgenesh1_pg.C_scaffold_3000082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]