SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI73413 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI73413
Domain Number 1 Region: 118-279
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000139
Family Trypanosoma sialidase, C-terminal domain 0.037
Further Details:      
 
Weak hits

Sequence:  164328.JGI73413
Domain Number - Region: 4-41
Classification Level Classification E-value
Superfamily F-box domain 0.00255
Family F-box domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI73413
Sequence length 332
Comment (Phytophthora ramorum)
Sequence
MAVLWSALPDEVLAAIARLLLGVDLLQLSHVDRRALCLLSDLFASRLSHVRYAREETASQ
RIANSKRAYAQASSLRFGGQPEETESRRLPQSFAPVFWSTDTLFGLFAREDGAGAPCFTL
DAWFSLSQPLQGVFLGGVLLGLQSEKCREDSGRWPDFHCQVLHVDAQRNLFCSVTAEKPH
VAVQLQLGRWYHVALVFDDQVQSVYLDGELVDTQYGQQHQLESYPYYYAQVGAGCISGDA
VGKPTDLYRGWYTFHGVVDNLRVWHEAMSAEQIAALSRDYAVLLRRPTFSLKRDVPAWMA
HGVETVRCSRPRERWCEVVAASKRTEDHESWV
Download sequence
Identical sequences H3GD08
jgi|Phyra1_1|73413|fgenesh1_pg.C_scaffold_3000170 164328.JGI73413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]