SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI75101 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI75101
Domain Number 1 Region: 2-125
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.86e-41
Family Calponin-homology domain, CH-domain 0.0000211
Further Details:      
 
Domain Number 2 Region: 223-283
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000000000131
Family EB1 dimerisation domain-like 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI75101
Sequence length 297
Comment (Phytophthora ramorum)
Sequence
MSLMDGTYFVGRKEILDWINNLCATNLAKVEQTCTGAVACQILDAMYPGKVQMSKVDWAA
NKDYEYIQNYKVLQKAFMQLKIDKHVEVDRLVRGKYQDNLEFMQWFKAFYERNASGQSYD
PLSQRDKGKGGAQFTQKFGGSGVSSSAPAAPARRKVGAATTSRVGRTPPAAPAAARASRT
PTGVSRRPTGSAGAVSAVDTEAAVAAATAPLEKELEELTTTNEALTNESGELRAMVESLE
KERDFYFNKLREVEIMLQAAEDTESNPLAQAVFKVLYAAEDGAEEEQVPGEPQDETM
Download sequence
Identical sequences H3GGV9
jgi|Phyra1_1|75101|fgenesh1_pg.C_scaffold_11000113 164328.JGI75101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]