SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI76303 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI76303
Domain Number 1 Region: 379-393,434-571
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000504
Family Glycosyl hydrolases family 16 0.018
Further Details:      
 
Domain Number 2 Region: 47-217,253-279
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000249
Family Glycosyl hydrolases family 16 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI76303
Sequence length 729
Comment (Phytophthora ramorum)
Sequence
MKRLQVVAVAATFIGVQAKTEYSTKSGILPWVDPATPSSRQTYTSSRGGTWDLVMSDEFN
TEDRSFEAGDDHIWTSMEKADGVNSALEIYQHNMTGTKCDDDETCYFYIEADTGETTLTL
WNDYLSPAGYEDVTFYYKGGMVQTWNKFCFQGGMVEVRAQLPGAVTNASGNPDVETGSGS
VRAATIDYYPTWPGIWMMGNLGRAIFSASTSRMWPFSYNECNDTIFDSQNQRISACDDDP
GSGMNANQGRGAPEIDILEGGGTAISSSVQVGPGMPEDFRLIADTESYSCIYTYDCTTDG
ANNPDVPTAYYEKLRGHKSWYQGLRYGANNFCDADSTLVQSYKTIAASLDEGITDNACTM
DLCPASYDVNGDLDYIDNGTVHWGVNTNGTCFPKQNAYTGAFLCSAGNNDTSCTASSGST
DAMSAFAYQMDAISSNWEIQVAAYTDWLTYQLEWVMGDDGYIRWMLGGEPIFEVPAETLT
NPPQDTAQMNPKKLMLEEPMYIIFNVALSSTWGTTPPNAGSGGCYGDGSDATTNAICDAF
PMYMKVDYIRVYQDKSDGSSMAVGCDPSTHPTKQWIEDNIDSYVDDDNPWTEVSGKAFCD
SNEDCTIETNSSTSVTTGTCVSGRCECSATSWTGPRCTVASSGSSDSSSDGLFSSNSYGP
PMYVSGVFLGITVLTTFVSVYLSILAARKGDELLQKEILARKGRGVPSPASLGESMAKSS
KDNYSTNFV
Download sequence
Identical sequences H3GJG0
164328.JGI76303 jgi|Phyra1_1|76303|fgenesh1_pg.C_scaffold_17000065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]