SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI76318 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI76318
Domain Number 1 Region: 55-224,260-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000023
Family Glycosyl hydrolases family 16 0.056
Further Details:      
 
Domain Number 2 Region: 446-607
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000122
Family Glycosyl hydrolases family 16 0.028
Further Details:      
 
Domain Number 3 Region: 1627-1650
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000314
Family Ran binding protein zinc finger-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI76318
Sequence length 1977
Comment (Phytophthora ramorum)
Sequence
MMRAPFVAAWALAVATTSVAGKNSSSSSEYPTKSGLKSWVDPDTPSDRQLYTTSRGRQWN
LVMSDEFNVANRSFQPGDDHMWTSLDKPDGVNGALEVYSHNMTSTKCDDDGTCYFYIEVA
SDNVTISVYNMYQHPPGYQNASFYYRAAMVQSWNKFCFQGGMLEVRAQLPGAVSKASGNP
DLALGKSGQVTETSYYPTWPGIWMMGNLGRAIFSGSTNRMWPFSYNRCEPKIFDPTNQRI
SACDDSPGYGLNPNQGRGAPEIDVLEGGGLAISSSLQIAPGMPIDFRLFAADTKGADATS
PYCVYSYDCKTDGANLIDVPTAYYKQKRGHKSWYQGLRYAANNNCAKKATKVQSFTTVNA
SVTRGITENSCTTSTCPASLDVNGDLGIIDEAGKNHWGINSNGTCYPIMNSYMGSYLCDP
DNSDGRCVSPRNSSTPRSNAMDPFNYQMDAISSNWPIHLGAYTDYLVYQLEWVTGVNGYV
RWMLAGNPLFEVTADSFSNVPQNANSSNPQKVMLEEPMSIIFNVALSSSWGTKPPNPGSA
CRGDGLDETVNKICDEFPMFMKLDYIRLYQDLGDDLDADNYMQVGCDPASHPTKQWIEGH
IDEYQDDDNLVTEVVGRAFCKTNNDCTIGGIFGRTDLITGTCVDSRCSCSYPESWVGPRC
TVALAESSSSKASTRVYGPPIVLPLGLAGVVVFLTFLSVFAGMKSAAKKNAAIVKATMMA
KSDAVARGADTGNYLPPKRRSVRCPWLLHGAGMLGIKPFVQESVQALPPPQLRLLAETLR
IDLRGCEDRGDIERVLTGLVCMDQDTSLGVFLAWLRSADLQQHKSGILASKKPTFNTTFL
PAIASSSEVRSSNQQAEPERQERVKNHHLNDEIEQQLAELQVLETSFKDAERLVHTGSPS
FEKLKRFLLELTHLRTKEQTARAFLVRQTNVLREQHDEMRAEMLHSRAQLDFFVEGFTNL
RKRHDALVVDATRMKAESETTQDMFVSMSAHDCYFEQLMRNTLWQQVRDNDEMKRRLQQA
HDDLEAAAQTRRELEAQISQLKHERGDARKDAYCYKRQLRVCKTRMRRLQQAGGGADGSF
FRSQAVALRQTVATLLGLLRDSVVRDTKSPKQTLSKEALRIIHQVLTPSLAAPENESHLL
RTVRDSDNQRDQESIETEPSEPRVVHRQTSLDIDEVIRGVLLVEGATPTDAAECADIMGE
KLKYLPVDLKQTLAQLQQDEENQAQAAREEEQRKLQLVLDQQQQSQQSEGQDTDGRGDSS
VAAPVSPTNASSQAPVQAITPVVPRPQPTLEAYASALKKHVSELMESQGKRGFVMHNWPF
TRRDVNVLTAMGLPVDSVINLEIAGDVQTPAPNSTAPATPSAVSTPATAVKPKTPVTATK
AATSSRKTPVASSAARGKASPTKSTATPKSPTKPAPRTAATKTRAASPTRATAASPKKPS
ASPSKPRTPTVPSTPTKSGSASSQLKPGAIDTVKAAKKVPTAASALQGLGGLLQFVGPAA
FPAERVNAILQTLEQLKRRKLAPVVHWDEATRRTNEMLAMWAEEVHMLVYLEQESRKPQK
PPPTPVASPTKSTTTSPKRAGRRVTCFLRAAMIDPSVFAALPLDIQQELLSASDACEPAT
ETEAHDADAWSCRVCTFLNHPQLAECEMCGVLCVPLDSTPQDAAQDAGRTGSRLGRTLRR
IKVPSTPAAVTFSQKREPTAEDLLVAASSSLQAVKTSWALQELTELQKNLTLKVEAGDEW
LEASLEKLWRAVQDGEQTQDFCRTRVDWVALGFQNASPETDFRGGGVLALKCLLYVFEAH
PQEMRAIQQAQTPGQDKKWYPVCVAGINLTCLLAGLLQLGDGRFFDTKQVFWELFEEPAA
FYELFFFAFLKMDAIWHRLNATYMEFGVVLKVTRKSVAFILEQAPASLMDLRIASDQAFL
DRFVVSLSARSLADWEEGECPDPNHALETEDVLVIAKTRAAPKSAGATKGDAFWPLR
Download sequence
Identical sequences H3GJH5
jgi|Phyra1_1|76318|fgenesh1_pg.C_scaffold_17000080 164328.JGI76318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]