SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI76319 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI76319
Domain Number 1 Region: 142-207,381-408,449-590
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000158
Family Glycosyl hydrolases family 16 0.023
Further Details:      
 
Domain Number 2 Region: 54-221,257-264
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000808
Family Glycosyl hydrolases family 16 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI76319
Sequence length 744
Comment (Phytophthora ramorum)
Sequence
MRLTAALATAVSVVAVATAKSSSSPAKYPTKSGIKSWVDPDTPDDRQTFVNSRGRKWDLV
MSDEFNVANRSFRPGDDHIWTSLDKPDGVNGALEIYSHNMTSTKCEGDTCYFYIEVSDEP
QTISVYNMYKYPPGYEDAHFYYRAGMVQSWNKFCFQGGMLEVRAQLPGAVSDKSGNPDLA
LGKSGKVASKQYYPTWPGIWMMGNLGRAIFSASTNRMWPFSYDKCEPDVFNPDNQRISAC
DDDPGYGLNPNQGRGAPEIDVLEGGGLAISSSLQIAPGMPDDFRLFPADAKGADATNPYC
VYTYDCMTKGANVIDVPTAYFEQVRGHKSWYQGLRYGANNYCQQDGKAKQDYSTVSKSVA
AGITQNTCTTDTCPASMDVNGDMDLIDGTGKNHWGINTNGTCYPIMNSYMGAYLCDPDNT
NTKCTSPRNSTTPKTNTMNPFNYQMDAISSNWPIHLGGYIDYLVYQMEWVTGEEGYVRWM
LDGSPIFEITTEAFSKVPQNTKKNNPQKVMLEEPMTLIFNVALSSSWGTKPPNAGNPCYG
DGTNEEDNRICDEFPMLMKIDYIRLYQDLGDDLPADSYMQVSCDPASHPTKEWIEGHMDE
YSDFDNPVKTVNGKAFCKTDDDCTIGGDVGTTSLRTGTCVKSRCACSSTSWSGPRCTDPQ
SGSSEKSSSLSKRVYGPPMGLSLGIGSLAILMSLISVWMAAISTAKETQKLMKSKELAAL
HETKANGQLSNGELPKDNYSQNFV
Download sequence
Identical sequences H3GJH6
164328.JGI76319 jgi|Phyra1_1|76319|fgenesh1_pg.C_scaffold_17000081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]