SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI76338 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI76338
Domain Number 1 Region: 35-107
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000299
Family Lectin leg-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI76338
Sequence length 123
Comment (Phytophthora ramorum)
Sequence
MTSTKCNDDGTCYFYIKSIDEVNVINVYNMYTHPPGYVDAYFFYRSAMIQSWNKFCYQGG
MIEARVQLPGAVTNASGNPDLAKGKNSKAKTTKYYPTWPGIWMTRNLGRAIFSGSTNRMW
PFS
Download sequence
Identical sequences H3GJJ1
164328.JGI76338 jgi|Phyra1_1|76338|fgenesh1_pg.C_scaffold_17000100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]