SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI79303 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI79303
Domain Number - Region: 48-108
Classification Level Classification E-value
Superfamily beta-Roll 0.0034
Family Serralysin-like metalloprotease, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI79303
Sequence length 240
Comment (Phytophthora ramorum)
Sequence
MSAHTAATASVNGFQLEESNKRFLRSYGMSDLDVKEDSSEEERGIDLTKLDDVINVVKGD
KVIDAAKVDDVINAAKANKVINAAKVDDVLNAAKVDDVVKVDKVVNAAKVDDVIDEGKLD
DLLQPDKIALALKDPDEEMALFAQWHESEELSKAILKRLHANGGFFKNQAIIFRTMDGRT
KQQIADALQPHPKLAKKFKVLESHYGLFVDYKAIEIKRAAAAEAKTAAEAKKAAEVVEAS
Download sequence
Identical sequences H3GR23
jgi|Phyra1_1|79303|fgenesh1_pg.C_scaffold_39000001 164328.JGI79303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]