SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI79952 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI79952
Domain Number 1 Region: 290-386
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000763
Family Glycosyl hydrolases family 16 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI79952
Sequence length 417
Comment (Phytophthora ramorum)
Sequence
MKVYGMFLMAAAMASAVSAGAGKICDMDPAPVATPAATTGTPATEAPVVETEAPVTETEA
PVTQDDTTQQTDVAGEADTSVAGSGDATQGSDATQQTTQQSTISGAAQSSAGTVSSAYSY
TGVNCGGPGSYDQVTDIGSCTKSSVTTTSPVSPLDSGVTLAFRGPMTISNIAVFDGNNGT
WSKVSSYENGGAATNMVFLNNENVDYTGAGSPEGFCEANGAGVAQQSTPFTGTLAAATNP
KSGAILASEATGAEVHIMTENQCGVDVECEGAYDTDGTAFQGWTGGKKIFVTKVSMENGG
SPDVPAIWMLPDQVTHSGQYGCNCRGVGPAGGCGELDIAEVLEKDTSFVATHFYFYDGTY
NPGNDQFAQRPTSGPATYVTIVDQDYGVKVLAIGADDFDFSCGSITDDVVSQWEAAE
Download sequence
Identical sequences H3GSH5
jgi|Phyra1_1|79952|fgenesh1_pg.C_scaffold_44000097 164328.JGI79952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]