SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI80137 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI80137
Domain Number 1 Region: 236-544
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.04e-57
Family Carboxypeptidase T 0.0078
Further Details:      
 
Domain Number 2 Region: 100-158
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000389
Family Glycosyl hydrolases family 16 0.011
Further Details:      
 
Weak hits

Sequence:  164328.JGI80137
Domain Number - Region: 672-736
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0732
Family LacY-like proton/sugar symporter 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI80137
Sequence length 829
Comment (Phytophthora ramorum)
Sequence
MALQIHRSRECELTRVWEANTSSFENLQQQVQWGKVDASVVTVSNGVIELHTDASEDTKL
EFSVAVGGNRTLHRLLFRTQLPQNGQATLKVVQSGLTMVYGSSPADAASNEVFVGSSQNT
SVAAELPCASDATDTFHDVRFEWDDKWLRWYVDEVLLLEEFIQGAGLEKSEGDSQVVVEL
SVGASGGDAKLAVERIVLGSGDSADPLCAPRYSSSSNCRPQESFAPRLGSIQGSLTVDEV
EAYIDEVTSAFPLISKVEELGRSVENRPLRALCLGACYAPEDQYIPQALFTGLHHAREPI
SMMNLVYTIDILTNDYHNGDLAALELLSSRQLWFMLVVNPDGYAHNEMLRVWEHNEMGQR
KSAAPTCDKSPRDAGVDLNRNYDVCFARDSKGSSNDPCGDDYNGPSAFSEPETQAVRDLV
ERNTSDFSVALNYHSYGKYFNLPFACKDEGEPTEPNNSMFMALAREMVHFNGFDYGQSWK
ESNLYTVNGETSDWMWQAHGIFAMSPEVGPSFDAKASPGFWPSRDDTPLLSAELHYSNLH
IARMAGPKYSLAVKGVQLGAIDDSGSTSSFVSVDVSVSNNGLRPASAELLGSMFVNGTSA
SDPIALELEAQPEGSGLATSEGVNTLLIPHYGGDFHQSMKEIQELYLVIRDAWSCHLFRV
APNVTAIATTTLASANTTSSGSASAETASNQQSSVSSILPSSVSWSGPVAMASLAAFVLL
VVAAIFFRRRRRRSKKKPARAKAASGVQKRRSNVQYSRIDEDAENSPAARGKQLNYDDED
EEIDLLDAECGERSATAGDEDIGVISKDRPQAPPRRTSRPLRSSREEIV
Download sequence
Identical sequences H3GSW1
164328.JGI80137 jgi|Phyra1_1|80137|fgenesh1_pg.C_scaffold_46000048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]