SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI82325 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI82325
Domain Number 1 Region: 341-492
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-28
Family SPRY domain 0.0063
Further Details:      
 
Weak hits

Sequence:  164328.JGI82325
Domain Number - Region: 202-220
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00837
Family CCCH zinc finger 0.0053
Further Details:      
 
Domain Number - Region: 25-56
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0855
Family Ubiquitin-related 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI82325
Sequence length 616
Comment (Phytophthora ramorum)
Sequence
MATDELQFLVHFNRTLCLSLDAGAASVERLASFVQQREGVPASLLDLYVDGRKLDDLAHV
PSFPAIIRARLRGGLRGGKGGFGAMLRSMGKASGAKATTNFGACRDLHGRRLRHVNQEVA
MSKWQQDGEARSKREKDGVTDQEMMDEETPSGIPGWYLATPSWAEGVKKSYMKRRRNTVL
CKSWAKAREGGRAPPDGAPRWWGCPRGRQCDFAHGEQELRGEGLTDFKRAKRDDAQRLKQ
QELQDYVDFEQEMPDDVLDAIKSGLRRRKTKAKAKMELQEADARVLPPDATTRISVRSAQ
HPPPVVEEWLELVGEGSEENATASVGTTFKHGLCELRGRGNFGTAAARHCCAVTKGKWYY
EVRLVTAGVVQLGWADSTFLANSETGDGVGDHERSWAYDGARQVKWNGGKDEEYAAGDSW
NKNDVIGCLLDLDEGTVSFTRNGIDLGVAFRNVKHTSSDQGFFPAISVEQTEILLVNIGS
QPFVYEAPGFEPVIDILEAAATDDSTVIPASVDVSGVAKATAKHPEGFTSEEVQLKSQSK
KSPATKTRSKTPQAPKEHEKKVTPTEPPIDLQKFETIDSLEALGLDSLKLELSRRDLKCG
YVYRGSEVAFWTVLVS
Download sequence
Identical sequences H3GXJ2
164328.JGI82325 jgi|Phyra1_1|82325|fgenesh1_pg.C_scaffold_70000053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]