SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI84056 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI84056
Domain Number 1 Region: 3238-3374,3405-3454
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.29e-17
Family Clostridium neurotoxins, the second last domain 0.073
Further Details:      
 
Domain Number 2 Region: 3022-3149
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000157
Family CalX-beta domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI84056
Sequence length 3666
Comment (Phytophthora ramorum)
Sequence
MQRFPVRTVLPLLSLVLACLPAGIYAAITGASVSPASLNAGAVSDVTVSFTVSVGVQVGN
SVLVDFPTGFQIPSDTTVAVQTAGSSTTLSVAAVSTAQISVLVEGATISADAAFSFTIAN
VRNVGAQTTGDFTISTYDDSSILLETDSAVPGVAISSTTLGDADVVPVSPDAGVVGKATV
TFRSAVGLPVGSLVKITFPSDFHVASTALSDASNIDGTVTVSGSDVIVEVVTSAVVAGTV
VAFKLDGVTNPSARTTGAFMVATMDSSLKLFQQSDVIAGIPISSTTLAGADVVPVSLSAG
VVGKATVTFRSAVGLPVGSLVKITFPSDFHVASTALSDASNIDGTVTVSGSDVIVEVVTS
AVVAGTVVAFKLDGVTNPSARTTVSPPLSPAVVKIDCLNGGVVGTATVSFTSAVELPVGS
LVKVTFPSDFQIASTALSDVSNIDGSSAVQVTGSVVTITIASTAVVANAVVSLKLDGVTN
PGAKTTGTFAVETMDSSLLLFQQSGLIAAVTIKSTTLADATVIPDTLEAGVVDTATVTFT
SSVGLPVGSLVKITFPRDFSVAATTISATSSIDSSSVINTSGSVVTVTISNTAVAIGASV
SFKLDGLTNPGATTTGTFAVATTDSSSKVFEQATAISGVTIDKTTLVGAAVKLDSLDAGV
VGKAAVSFANAVGLPVGSFVKVAFPDDFQVASTALSDTSNIEGTVTMSGSEVIITITSNA
VAKSAVVSFKLDGVTNPGAKTTDTFVIATMDSSSNVFQQSDPIAAATIKSTTLAGVSVQV
DSNIAGVESIYDVSFEMKAAIPVGGYFVLTVPSDYILSGSITLVDPTLPGVWDGTINGQG
IKFKALSLYAAGQHSIQVKFLQNPGDYDAAVPILSVVVATPAGISATASWKSSDTAILVS
FTSPTTVAHGAAVALQVTALEMPQSIRASSTAGTMESWNAEGLQLDKSNTLSLSALTAVT
GLPCTWVTETPNPGITSNVLVTFKTNGMIPVGGKIVLTLPASDFYADSVGNTPSVVFKNP
STVVVATSIWDKASNTLEVVTSGDSIPAYTTGVQVKILKLDTPMSVRTASRLPASLTTLD
PLGIEIDGPSVLQLDAITAGFILGSRVWTAANAVPGVTSVQTVDFFITGRMDPGGKFEFT
LPDSQWSMAATTVATFIAPALGAVGSVVWNEPTRMMTVTLTGTTSIPAYTGVTLTIEDVT
NPPKETGINNAYLTTRAADDSIIDGPDTVSVMTISRGALVGAKTWTAVTSASASVKSDQL
LRFTLSGALPSGSIILATLPTGGWRMVDSTSVSVSFSLPATGVTVQSATWFASTYKLQLV
TSGDLVEGASVELLVKDMINPFSSSAASVCTVTTMLADLGVVDESKDIVVNPVVSEALPT
EGSWTSTKSTPGVLSTQTLTFTTGGKLEPDAKFCITGDVWTLMASTSASMTLAGSGQPSL
LKLTSDSRTLCMQTPVGVDYVTDVTIVLTDILSPQSVRLDRTEPLLIHSHLGGDVNTGSI
RLNAVTEGALTGPLTWKTLFFSPGPVAGLKTSANLALRTTGQIDAGGYIKVELPSEWVMA
STCTATFVRPSVLGQASCSQNQISIRLQDSLNEATDLDILFVGVYNPPTVMPEGTASSWT
IATDGGKIDESNSITTGAILCAVTGVTNSGDHLVAVVGAAKTFAFDGSALAQGDVIKFVD
ASTTSDANCGVSTTGQSDVGGIGVKFLSASQDVTLKFTQSSPDGQPFAICYKFGENPFKL
YPALSIAVKEVKSVTAAVGSSNIAVVDFVKTWIFGGNGIVAGDQVRWIDLDVVESAAYVS
TPPDCLDTSTLAKLSAPNSGTLNAPEDDYTRIVGVGAATSYAFSVESSGKTYCLCYKFGS
EPFKVYPLVKVEVNHLRSIEATSTGSDTVVVVNAPKTFIFFGDGVSSNDRLYFVEKGSVS
SCTDSNNDPTLQLTHFVDEQVRSTLFISSDLVTGVNFEASAAGMTVVPCYQFGLEPYQLY
PEIRLTVKMITKYTGTLGSPKLAVVDVPEPLTFLGYGLSGGDKVRWILRGEEDCESSLAS
LTQPTTLEFVDTITLDSNNAGLFTFASTQSDFNPALCYKFGEENFVLYPDISIGIGTIRG
KATLTGATDVAVVGSRKVLTLLGTNLAEGDRVGWTAVLDSGTPCSKLSVLIANPLNTDND
YLSYLTSTDTFGVAMASLSSGKRVYLCYGFGQEPFKLFPDLYLNVKSVTNMRALVSSPSV
AVAGAIKTFLFDGDGVATGDFAKFVSSDSQDCSVPGVSLLNIIKEFDDYDEMAMYLYEIG
DSTTTGSFQVSSDKSSAGLDRVLCYRFGAEPFAYYEHFHIDVKAIWGLLRTDKTGGGQDN
VMVVDEPKQMTIDGIGMSVKDALKFVLAATHSGDADCVDLPAQGQNNGRLQVNADLTVWL
PFEFGSEGGTWALCYKFDDEPYRLYPSVAVTVKEITALLDYTFQDIEGLGGVATIGHRKE
WNPVGSGIQQGDTVKIVTQSVTSSSDCGKGGANAASGTSVMTVGSKLMFSGIISAYPAST
SDVYHLCYQFQDEPFTYLRGFTLTTYGITNLDRSVVLLSATTTAQITGFRISDTDEMGWT
TSSTDCSTMLGRTQVSGSKGNVFFKDSYTLLYFCYSFDRQPFDVFKTVTLAVVKAEIWSP
QTVSIIADQTAAIAVSGTFGITQGTDQIAWVPSDVVECSPDAVAQYAGVMQTSVASVAKS
QSIIPRAGGASFNAKYVAPSSASGMTATDSFSTWKLCYRFGTTPSYLMFGDVLCTVLNIV
QVLLISQDPTSSGAVLKFEFDGIGMQDFDAAKWVDASAASTDEHCSSLPAVGGSKTRDVV
NSRATFTFVEESTAMALCYRFLGHAFKLYANIPIQSSVKTTASSEQSSTGAILTSYDEEA
VAAASDQFTASREIATISLTLDKDIGEIPAGSNAERDFKASFVATLATSLGIDPSRIQIT
GLVAGSVVVNFQLLASANPADPSVSEAVQDLHTQLTDTRSKLLSTNTVVVKNAATALSVT
LATPPLPAASPVAIQALGYQSNGLFSFVRSIYSVTEKSSKLTIPIVRLQGTASVLSIKVQ
LQTTGTSAIYGDNYAFPPPATFDGSLKLLYLTFKIGQALQTIELDILDDNVKGVHFKTLS
LALLNPQTAGATLGSTKETVVRIYDYDEGVSLANSSFTTNSADLTDQQHLQHGWQVVGNG
ASPLRVDGNGLFAVDDVLGEAEYNQKCDLAAPTGVCSYSCELGGGLTSALGLEAAYNVLA
LDGDDYVASMNAISAFPSEALTVSLWVKTTQTDPAACLYSYAATAPAVPLALCNPSNLQL
FIDAESDVSGLSTFVNVSDNAWHFLAVTWTSADGRVRVFDNGMLVFDGGPYREGKALQAT
GFLVVGHLVLSSTSKAPCTVAVEAATASTGTSSLLTEVTEDVRCNVVTGSGFKGQVQHVH
VWSRVLARSELLGELAWPLRVASNGLVLGWNFATSFLLRQGRVVNDLSMQGQEQKNLGVL
HCSSQNLSSLQLASTPEPNTSSTGVDRCLLRGEVPRLDATFPCGPVFANVWHFSAPAAFT
TKLAAAYGGRLQFRLLAPSFNGSPRPRRGQVAIFGKNADGIATQMSVALGSFDLPSASRW
TYYSVVLREDFGWITEPDGASITAAAFKAVLGGATRLWIRGDIWGYDPTGAGQEVVYLND
VVLLAR
Download sequence
Identical sequences H3H1E4
jgi|Phyra1_1|84056|fgenesh1_pg.C_scaffold_102000038 164328.JGI84056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]