SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI86023 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI86023
Domain Number 1 Region: 490-629
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000158
Family Glycosyl hydrolases family 16 0.016
Further Details:      
 
Domain Number 2 Region: 203-270,320-361
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000302
Family Glycosyl hydrolases family 16 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI86023
Sequence length 635
Comment (Phytophthora ramorum)
Sequence
MRFYHLVLLMVAVLFASAGPTSAYRGSKLTTPEAQAQVLQDNTPTKRLLRAYTDDEERGI
SIPGLESVLKVFPSSKTKQLQGLLKADETLGNAFKTLGLSKMPIGKDDFIETKMVVKLFS
STNFKVWSKHAARLNKQDPEGAMLTSLTNVFGEKNVATMILLGKHTQSSRQVANKLEAAQ
FKKWATTYKYTADDVFVKAYFFYRSAMVQSWNKFCYRYQGGMIEARVQLPGAVTKASGNP
DLAKGKNSKAKTTKYYPTWPGIWMMGNLGRAIFSGSTNRMWPFSYNKCEPDLFDPSNQRI
SACDDTPGYGLNPNQGRGAPEIDVLEGGGTLVSSSLQIGPGMPDDYRIVPVNFTTGDYYA
CIYAGTCMTPGANYVDVPTAYYKKERSYKSWYQGLRYAANNYCTPDPDEKQRYKTITASL
KTGITNNSCSSDVCPASNDVNGDLSLIDGKGEGHWGINSNGTCYPLFNVYTGSYLCDPDN
TYSKCAAPRNETTTPKSNAMSSFNYQMDAISANWPVHLGAYTNFVVYQLEWVTGKNGYVR
WMLEGNPLFEVASESISKVPQNSNKTNPEKIMLEEPMYIIFNVALSSSWGATPPNAGKEC
RGNGTDPVVNKICDSFPLYLKIDYTRLYQDLAGDL
Download sequence
Identical sequences H3H5U1
jgi|Phyra1_1|86023|fgenesh1_pg.C_scaffold_422000001 164328.JGI86023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]