SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87218 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87218
Domain Number 1 Region: 3-139
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.97e-30
Family WD40-repeat 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87218
Sequence length 141
Comment (Phytophthora ramorum)
Sequence
MKIHLFDVVNGSSLVESGEITGHLGALTSVAFSPDGSLLAAGDTYREVRVWDVASRSAKV
QGMWVFHSTRVTSVAWAPSGNFVASGSLDERIYIWDVNSPMKKRLFDFSHKDGVTGVSFA
SETELVSVGNDACLNYWDLSA
Download sequence
Identical sequences H3H8S4
164328.JGI87218 jgi|Phyra1_1|87218|fgenesh1_pg.C_scaffold_1682000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]