SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87622 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87622
Domain Number 1 Region: 59-106
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000538
Family Zinc protease 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87622
Sequence length 124
Comment (Phytophthora ramorum)
Sequence
CDQSCYRFYDAGLQTWTDTSSCKGEPFDLSLWPKQGLEGGFGYDWGQEVNLENMLSTVDE
DQLVIVAHEIGHGFGLPDFYEDADKPNAQWPSCIMMAGSSMTVTPSDGWMLRRVLEHIKS
RYNF
Download sequence
Identical sequences H3H9S4
jgi|Phyra1_1|87622|fgenesh1_pg.C_scaffold_2271000001 164328.JGI87622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]