SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI94070 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI94070
Domain Number 1 Region: 89-221
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000058
Family Laminin G-like module 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI94070
Sequence length 408
Comment (Phytophthora ramorum)
Sequence
LLDNLSMWLAADSGVEVENLAACLASSGDDVTACGVISWTSQIVNSDNYAADAIAFHAAS
PQQSTVWVPIAPDTHSQLPAVYFSCPMVTETGRVHESMTLLFVISPAQIVEQGDLYTGQK
FFGNSPYGQFALHGGKPSFYANNGLVESDHVLPVGRFSLLTYRLHSGYAEIKVNGGPWGG
ESPVEGDTDERHVRITVNEVGRIAEVLVYDAVLDNAQVEAVEKYLYDKWWGNKPFPETVA
ATSEPGPATEAPHDEIADVLPALNPDLTDPEPASKDPHAEDANGSPTTDPIDPTAIETVS
VGPENEPSATGKALQTSSTARQPDGGLTTAAAAETEAAPASKFDPRINIFEWTPPSEGDT
SPAKEQWARTVKERVDLIHNFQLGGDVLRALIRQHRDELVALRDELFG
Download sequence
Identical sequences H3HBE6
jgi|Phyra1_1|94070|C_scaffold_11000094 164328.JGI94070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]