SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI94776 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI94776
Domain Number 1 Region: 537-689
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-18
Family SPRY domain 0.0052
Further Details:      
 
Domain Number 2 Region: 751-857
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000468
Family NPCBM-like 0.027
Further Details:      
 
Domain Number 3 Region: 287-377
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000134
Family APC10-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI94776
Sequence length 876
Comment (Phytophthora ramorum)
Sequence
MEAEELDLLRANAAVTSSSVDTSDPGPGEDVVVSANDAAPQTEAPRAEAEAWGTGDDEDG
WMPKPARLHSGRTRSCAVCFASLQYTVATSWDEYLQSEEYLQQLQANVLQDAFVSALICG
ENTAGDLPTEHRMHKNRKLKCRQSVADYRNMTSAGVVDKSGMEKGSIRTLEEMLIEALPT
PVFTHVLERRLAVISHSSKITCELMSHDGVKKIPRPVETAPANEELHHLAIHTLSALLGA
FDYKNPQALRPFEELSQLLTCFPVLSLYSFWSPTKKAPDKALVLSKKAVEASSVTSSSDS
HGAHCAVDGVDNTFWQSQPRPGIVNFILRSTELEKVTSITIDWHMKYVPQGVGVQYREKG
SEKFVQLVEDRAVSPSGPTLIEISFPPSCQEARIVMSGTPSSNRNGTYAIEHLRLKMPAP
GSLFTDPKSTLSAVASWLLGALETADEVMAAEAISALRAWALSTASLSVTMQFVNMLLSF
KGQVEDLSRDRIAALALEQGRQLYNGINAYHREKSQRLAYEGDKIGFGDVRRVAALFESS
VCSTGVIVEDGGLVVRTRETSYQYAAVNCGISSGKASWKFRLDTDTQDDEMTCFGAAILP
VTVNGYDSSPSLWMLRGYNGNLYARGHKLSRTIGKVHPGDIIQVDVDMSEGSLSYKINGT
DYGVVFTDLAGHEVHPAVSFYGSGKVITLLGVTKWDCTSTGPADIDPVFLSSMREHHFSV
GYGTLGKGGQLGYASNGDSNAASGNSPATGSTSIHINDEAKQRCLSTHPPSHGDAYVIYD
LSEAYNMISGAVAINDDTRNEILQNRGVSLVFNIIGDDKLLWQSKPMSEIHLIEKFEVPV
KDVRMLELKVSCSGSNHSWFGTFEFVCVIHEAPCSF
Download sequence
Identical sequences H3HC40
164328.JGI94776 jgi|Phyra1_1|94776|C_scaffold_24000004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]