SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI95689 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI95689
Domain Number 1 Region: 481-767
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.76e-76
Family Regulator of chromosome condensation RCC1 0.00083
Further Details:      
 
Domain Number 2 Region: 736-865
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.71e-24
Family Regulator of chromosome condensation RCC1 0.031
Further Details:      
 
Weak hits

Sequence:  164328.JGI95689
Domain Number - Region: 1488-1521
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0137
Family Laminin G-like module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI95689
Sequence length 1521
Comment (Phytophthora ramorum)
Sequence
MQRDNASGTGYEPRSVQLATANSSLRPDLRWGRLSFAQFRDEEFLAKQLRRIEITQGARR
AGRSAHAEAVTLTGLAPDKTIRQRLVAAQTKAARGASEDEELDSKAETLATEVTVKTDDE
HERELTNALCVLGDLQQPELATLMATTLKDALGRGCTFPNPVYQLIALRRQLVKSMHEAV
AAQHRQRKTAVQVNAAIAKCLETSQVSVEAAQSLPDVVGALTTIKPKEKVAREASMGIHV
LISFLSDLHDPAVSTLSQRREFLEDLLPLLRSMGFLSLSPRTNSSGAPLTARGVSSRTTD
IAEFTEKIQRFLLDMCPRYTSIPSSSPKLPAISSGSSECDVLDRTNAVNGLIHLAAATGS
LTAKEAGVTRPDSSKPQKGGPLSKRETEILGDGAVQDTLRRKALPKGMKAIGASTNGVVT
ARCPKFKALSIQSVLVELNQAKPAAITRASRGKPSSSLPTANAGGFSNDASAFAGDDDEG
DREAWSCGQNSYGELGHGDTASRKSFERIESLQQKEIVQIGAGNEHTIALTADGKVLTCG
YNDNGQCGQGGTARVSHLSEVPKLGENSISQVHAYNGCEHTILVTMEGRAATCGYNYRGQ
LGHGNTASESVPKVVRSLENRIVRLVSCSYYHTVMACEEDGSGQQFLYTFGRNDYGQLGH
NDSIDRKVPQHVEALNDQHIVSVACGQYHTMVVTATGKAFAFGKNDYGQLGVDSMENQLV
PVQVRAGLEKQECLEIRCGYYHTIALCSGAHLFGFGRNDYGQLGLGRSGASLAANLQLQQ
QRFSYARLIEELEGKDIVRFACGCYHTVAVSDNGVMYVFGRNNHGQLGTGDTNERLYPFP
IDDFVGKRVALVAAGFYHTVVLTGGKDDEKNDQDAAGNDKGEASTAPVSTGDALFVATVI
LAQLERLCQPFIPKPGSYPTLHHPPVGVVESLVANTATSSFDLLRSGMAKAVILLSTGMK
ARKPPVKDAKAWATELDRMRAAMLQSSGQVAQQENQGECVSSVTELYQLLLERIAADFAR
RLGEVVAARPSSADKVPVAWRSYIEFAMAAMGQCCEVLGQFSNNALFAAALLPTLKTLLR
LLDGFNRRDAGVEDAEKLFVDSVASSVGPRPPQKENGGSFRCKSDGNLLSLGSARDADGK
TTGRKGLTTSEAMALPWHYRLEKELAVLAAEMAVTLVIGDPFFTYGQDDALGSGKLFLAS
LQRAPDPLVGGAATKLCEWVRDSYAKKDPSYRMIVRQSQLSMNLKTPANAIDRQCVSQLR
RRVAAKKTEIKSTPTEAAESPRMSAQDRIVAFQQTILDRCKLLLLVDVHEEQEHLNLQLD
AGYIAPYDPAFLVSASSAFKLSAPSAKRHLHATYTDDKLPFLTAFPLSKWRKNVGYFYSS
LQSETFSEFLGRLTAMMTDKAVLLMEPGEADTTATFWIVIVLLSAWGIHFKADQFEFLVF
MRGAAREVSLYLVLVPESIDNWQLEVGILMDLNREADGGVREFAVKGRIWERVLSKQAVA
GGKWIHVAVVLEATKIRLYLN
Download sequence
Identical sequences H3HD12
jgi|Phyra1_1|95689|C_scaffold_48000026 164328.JGI95689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]