SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164546.RALTA_A0092 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164546.RALTA_A0092
Domain Number 1 Region: 2-129
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.3e-23
Family Single-domain sulfurtransferase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164546.RALTA_A0092
Sequence length 130
Comment (Cupriavidus taiwanensis)
Sequence
MQHLSPTDANALLAQSPETLFIDCRSEMEYLFVGHPKGAHNVPWNDGPDWEVNPHFVQMV
KKLAGQASARPVLLICRSGNRSSAAARALEGAGFSNVQYVLHGFEGDLDAQRHRNTLNGW
RHDGLPWEQY
Download sequence
Identical sequences B2AG66
WP_012351434.1.21467 164546.RALTA_A0092 gi|188590887|ref|YP_001795487.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]