SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164546.RALTA_A2539 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164546.RALTA_A2539
Domain Number - Region: 23-91
Classification Level Classification E-value
Superfamily POZ domain 0.00863
Family BTB/POZ domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164546.RALTA_A2539
Sequence length 99
Comment (Cupriavidus taiwanensis)
Sequence
MNPNVREYFIQGITKEGKTFRPSDWAERLCGVMAQFRPEGDSGDPRLTYSPYVRPIFAGN
VKCVVVDVRLRDIEPKALDFVLNFARDNNLQLVEACSLE
Download sequence
Identical sequences A0A022G675 A0A142JNP0 A0A1C3TXM4 A0A1E4QX27 B3R6B2
gi|194290624|ref|YP_002006531.1| 164546.RALTA_A2539 2006685957 WP_012353767.1.21310 WP_012353767.1.21467 WP_012353767.1.30540 WP_012353767.1.32076 WP_012353767.1.39665 WP_012353767.1.63293 WP_012353767.1.70551 WP_012353767.1.84351 2006516976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]