SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164756.Mmcs_3610 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164756.Mmcs_3610
Domain Number 1 Region: 7-130
Classification Level Classification E-value
Superfamily Globin-like 5.96e-36
Family Truncated hemoglobin 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164756.Mmcs_3610
Sequence length 131
Comment (Mycobacterium MCS)
Sequence
MTQPTRSFYDEVGGHETFRAIVARFYELVREDEILRPLYPDDELEAAEVRLRMFLEQYWG
GPRTYSDQRGHPRLRMRHAPFRIGYIERDAWLRCMHTAVAEIDAVTLDDEHRRELLAYLE
MAAQSMVNSPF
Download sequence
Identical sequences A0A1A0T9F0 A0A1X0GJ20 A1UJ69
gi|126436192|ref|YP_001071883.1| gi|119869715|ref|YP_939667.1| WP_011560992.1.20321 WP_011560992.1.3374 WP_011560992.1.37251 WP_011560992.1.44017 WP_011560992.1.47369 WP_011560992.1.73225 164756.Mmcs_3610 164757.Mjls_3615 189918.Mkms_3683 gi|108800576|ref|YP_640773.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]