SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164757.Mjls_3718 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164757.Mjls_3718
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000231
Family Single 4Fe-4S cluster ferredoxin 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164757.Mjls_3718
Sequence length 63
Comment (Mycobacterium JLS)
Sequence
MKVRVDEDRCAGHGMCLTLCPDMFEMTDDGWAVADPEEVPAELESAARDAVANCPERAII
EID
Download sequence
Identical sequences 164757.Mjls_3718 WP_011856247.1.44017 gi|126436294|ref|YP_001071985.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]