SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164757.Mjls_4202 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164757.Mjls_4202
Domain Number 1 Region: 9-67
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000508
Family Single 4Fe-4S cluster ferredoxin 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164757.Mjls_4202
Sequence length 74
Comment (Mycobacterium JLS)
Sequence
MADSQLPLVITVDRSKCCGYTLCAAEGPDVYTIDDAGYAVAPESVPLELEAQARRGAQAC
PAEAITVRRAEAGK
Download sequence
Identical sequences A0A1X0HAX4
164757.Mjls_4202 gi|126436774|ref|YP_001072465.1| WP_011856605.1.3374 WP_011856605.1.44017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]