SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 167539.Pro0933 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167539.Pro0933
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily L28p-like 1.81e-24
Family Ribosomal protein L28 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 167539.Pro0933
Sequence length 78
Comment (Prochlorococcus marinus CCMP1375)
Sequence
MSRVCELSGTRANNGMAVSHSHIRTKKLQQANLQKRRLWWEEGKKWLNIRVSTSTLKTIQ
KKGLDSYAKSQGIDLKKL
Download sequence
Identical sequences Q7VC09
WP_011125085.1.25276 WP_011125085.1.37041 WP_011125085.1.47494 WP_011125085.1.71786 WP_011125085.1.74834 167539.Pro0933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]