SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 167539.Pro1023 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  167539.Pro1023
Domain Number - Region: 18-44,112-141
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0667
Family Poly(A) polymerase, PAP, middle domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 167539.Pro1023
Sequence length 267
Comment (Prochlorococcus marinus CCMP1375)
Sequence
MNQLKIFNVFSKFGYMFVNDVLVDWLTAFSLNFLLIAFAQRYPLLTRIGWVHAGILGTIL
WGCLGWTGWMTVVIYLVLGSLVTKIGYSYKKARGIAEGRDGRRGPENVWGSAATGAILAL
LFKLFSSFSQYQYIILIAFASSFSSKLADTFGSEIGKRWGRKTFLITSLKPVKAGTDGAI
SFEGTVASLVGSFVMTLVMYVFSFVNSFSAFLIVLLSGFVATIAESLFGAIYQDKFKWLT
NEVVNFLQTSFASILSIWLALIFLTTS
Download sequence
Identical sequences Q7VBR9
gi|33240473|ref|NP_875415.1| 167539.Pro1023 NP_875415.1.92868 WP_011125175.1.25276 WP_011125175.1.37041 WP_011125175.1.47494 WP_011125175.1.71786 WP_011125175.1.74834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]