SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 167542.P9515_05941 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167542.P9515_05941
Domain Number 1 Region: 296-377
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.09e-16
Family Cold shock DNA-binding domain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 133-227
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000025
Family Cold shock DNA-binding domain-like 0.018
Further Details:      
 
Domain Number 3 Region: 208-287
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000101
Family Cold shock DNA-binding domain-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 167542.P9515_05941
Sequence length 408
Comment (Prochlorococcus marinus MIT 9515)
Sequence
MKGVNDKGAQNDKKIKGQKNDVKKPLQVLHISKKDSEKEKEANFDDNQKLSNGITKDINA
TKPQIIEAPLNEDKENHSANINLENKSYQELAKPVNFKDEDQEFIIERKVDEFDFDENAF
LEALNENEPIGTTGETIKGKIIALESDGLYVDIGGKAPGFMPKKECGLGVITNFKEKFPI
GLEMEVLVIKEQNADGMVTISSRALILRQSWEKVENSAKNGELIQVSINGFNRGGLTCDV
DGLRGFIPRSQLEDGQDYQSLVNKTLKVAFLEVNPESRKLVLSEKKALLVSKFSGLKLGQ
LIEGEVLGIKPYGFFVDLGGASGLLHQSSITNGSIRNLREIFEEGELIKALITEIDLERG
RIGLNTALLENSPGELIVDKGKVMLEASERALKAKALFDKKNLQNDSQ
Download sequence
Identical sequences A2BVJ2
WP_011819910.1.83733 167542.P9515_05941 gi|123965829|ref|YP_001010910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]