SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 167546.P9301_02021 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167546.P9301_02021
Domain Number 1 Region: 36-178
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.69e-35
Family Predicted metal-dependent hydrolase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 167546.P9301_02021
Sequence length 179
Comment (Prochlorococcus marinus MIT 9301)
Sequence
MKEKIISEISLDLVFQCNDFSQFSNKLKDTNTHLIFESIFWEKVFLSWINTILKKEDYEL
PNYIFEKKSFSLGLQIISNQEIASLNKKWMQKNGPTDVLSFPIISDESLNNLDHIELGDI
FISLEMALEQSYEYKNSIYREMIWLASHGFLHLLGWEHNNEHDLENMLNFQEYLIKKLD
Download sequence
Identical sequences A3PAQ0
167546.P9301_02021 gi|126695540|ref|YP_001090426.1| WP_011862227.1.29415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]