SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 167546.P9301_09631 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167546.P9301_09631
Domain Number 1 Region: 13-111
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-22
Family Chaperone J-domain 0.00057
Further Details:      
 
Domain Number 2 Region: 226-308
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000000000000196
Family HSP40/DnaJ peptide-binding domain 0.0058
Further Details:      
 
Domain Number 3 Region: 158-208
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0000196
Family HSP40/DnaJ peptide-binding domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 167546.P9301_09631
Sequence length 319
Comment (Prochlorococcus marinus MIT 9301)
Sequence
MVILGTMIHGTMTTSSKKDYLSILGLSPDFDDKELKKAFRREARKWHPDLNKNDLNAEER
FKLINQAYEYLRNPNIRKDISDENIQDDYENNNFKTGFPDFQDYLDSLFGYEYSPKNYED
YDNEPFEDESINTNNDEFNNYEYPTTSPVEPPPVKLHQDIETIIELTPDEALNGASILIE
LEDETVVEVDTPPFAGDGWRLRLENIARGGKDHYLQLKVQTESGLRIDGLRVLYKLELFP
HDALLGCAVEVPTLEGNVTLQVPPKSSTGRMLRLKGRGLTFEDNVGDQYVEILVVIPADI
NDEEIALYTRLQELSLSDS
Download sequence
Identical sequences A3PCW1
gi|126696301|ref|YP_001091187.1| WP_011862934.1.29415 167546.P9301_09631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]