SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 167555.NATL1_11661 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167555.NATL1_11661
Domain Number 1 Region: 44-127
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000595
Family PDI-like 0.052
Further Details:      
 
Weak hits

Sequence:  167555.NATL1_11661
Domain Number - Region: 19-51
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 0.0157
Family RalF, C-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 167555.NATL1_11661
Sequence length 136
Comment (Prochlorococcus marinus NATL1A)
Sequence
MVFFLKRLLLPLIGLLLLPSVVTSGHLGTKKELIITTESTKQSIDLAKHLTEQGVVKYSA
YWCPNCLYQSELFGKQAYEELNVVECARDGKNSQTQLCIDKKIEGFPSWEINGKIIIGAK
TLKDLSELTGYRSGSD
Download sequence
Identical sequences A2C2L4
gi|124025873|ref|YP_001014989.1| WP_011823823.1.44141 167555.NATL1_11661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]