SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 167555.NATL1_16651 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167555.NATL1_16651
Domain Number 1 Region: 300-496
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-47
Family Ribonuclease PH domain 1-like 0.0000123
Further Details:      
 
Domain Number 2 Region: 5-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.42e-44
Family Ribonuclease PH domain 1-like 0.000025
Further Details:      
 
Domain Number 3 Region: 143-226
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.67e-27
Family Ribonuclease PH domain 2-like 0.0021
Further Details:      
 
Domain Number 4 Region: 459-557
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.98e-26
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 616-702
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.4e-19
Family Cold shock DNA-binding domain-like 0.00065
Further Details:      
 
Domain Number 6 Region: 227-333
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.7e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0022
Further Details:      
 
Domain Number 7 Region: 557-628
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000266
Family Eukaryotic type KH-domain (KH-domain type I) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 167555.NATL1_16651
Sequence length 722
Comment (Prochlorococcus marinus NATL1A)
Sequence
MQGQTKSVSFDGREIKLTTGRFAPQAGGSVMIECGDTSVLVTATKSSGREGVDFLPLMCD
YEERLYAAGRIPGSFMRREGRPPERATLISRLIDRPMRPLFPGWMRDDIQIVATCLSLDE
RVPADVLAVTGASMATLMAGIPFQGPMAAVRVGLLGDDFVLNPSYREIERGDLDLVVAGT
PDGVVMVEAGANQLSEQDVIEAIDFGYEAITELINAQKEVLKESGIKQEMPKAPEIDDTI
STYLDKNCTKSISEVLKNFDQTKEERDNKIEEIKISISAKIDGLKDDNAVKKSLSLNNKL
LENSYKALTKKLMREQIIKEGKRVDGRELNEVRAIEADAAVLPNRVHGSALFQRGLTQVL
STATLGTPSDAQEMDDLNPNTDKTYIHHYNFPPYSVGETRPMRTPGRREVGHGALAERAL
IPVLPAKDTFPYVLRVVSEVLSSNGSTSMASVCGSTLALMDAGVPLKAPVGGAAMGLIKE
GKEVRILTDIQGIEDFLGDMDFKVAGTEKGITALQMDMKITGLPIETIGEAINQALPART
HILGKMLDAIETPKDNLSPHAPRLLSFRIDPELIGTVIGPGGRTIKGITERTNTKIDIED
GGIVTIASHDGAAAEEAQRIIEGLTRKVHEGEIFPGSITRIIPIGAFVEILPGKEGMIHI
SQLSEARVEKVEDVVKVGDQVTVRVREIDNRGRINLTLRGVSQNGGMSNYPEPTPTPVAP
LT
Download sequence
Identical sequences A2C412
WP_011824227.1.44141 167555.NATL1_16651 gi|124026371|ref|YP_001015487.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]