SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 167879.CPS_0416 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167879.CPS_0416
Domain Number 1 Region: 6-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.83e-22
Family Single strand DNA-binding domain, SSB 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 167879.CPS_0416
Sequence length 104
Comment (Colwellia psychrerythraea 34H)
Sequence
MIVSQENCLVLIGEVVRTPKQSTSPAGISHSQFSIDHKSIQNEAGMNRQAFVRIQVVATG
DLSHLTRELIAGNVVKVTGFINRHESRNGNPLLALHAQQIEMIN
Download sequence
Identical sequences Q489U0
WP_011041277.1.15195 167879.CPS_0416 gi|71278817|ref|YP_267174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]