SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 167879.CPS_0441 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167879.CPS_0441
Domain Number 1 Region: 45-211
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.13e-20
Family Legume lectins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 167879.CPS_0441
Sequence length 263
Comment (Colwellia psychrerythraea 34H)
Sequence
MVRLLQLVHIFNFMVNYLMNKLQKILIALPLSVAFTSSAIAGLISEDFNSGSPAGVSFYG
PSSVINQEAQLTPSSNSLLGGMSFTDQDNGQLIEAWDANFDFRIDQNGNGGADGISLTFS
RLGDVGAAGEEGLFSGLAIGFDTWSNGEVSGNHISLRYDGVSLVEQNISTTILENGEVHS
TSISMIDGLVSVSLDGTSLFTHDVANWAAYSGQFNFGARTGGARSRQVVDNFIGSTVAVP
EPSMLAIFGLALFGLARRKTVKK
Download sequence
Identical sequences Q489R5
WP_011041302.1.15195 gi|71277757|ref|YP_267199.1| 167879.CPS_0441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]