SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 167879.CPS_3723 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167879.CPS_3723
Domain Number 1 Region: 67-327
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.43e-71
Family Glycosyl hydrolases family 16 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 167879.CPS_3723
Sequence length 330
Comment (Colwellia psychrerythraea 34H)
Sequence
MYAQGQLVIDELDIKLARDGKNNSELVRAVHDVTVTDGLLNIELKASKGQAILNALVVRK
TTTTSVDIQTSNDWELVWNDEFDYEGKPDPNKWSYDIWPAGKVNDEDQTYTDLLENVQVK
DGNLIITAHKEDYGNAKYTSGRIHSQGKGDLLYGRVEVRAKLPKGQGTWSAIWMLPSDPF
KYETTCSQDEDWQGNSTCDAWPNSGEIDIMEHVGYDMQTIHGTVHNKAYYWVNSEQRKAS
FEGETVDQAFHVYSIEWTPEHIIVFFDETPYFFYSNESTGWEAWPFDHPYHVILNLAIGG
SWGTAGGPIDDSIFPVSMEVDYVRVFKPLP
Download sequence
Identical sequences Q47XT0
167879.CPS_3723 gi|71280425|ref|YP_270390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]