SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 169292.cauri_0822 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  169292.cauri_0822
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily L28p-like 8.04e-27
Family Ribosomal protein L28 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 169292.cauri_0822
Sequence length 78
Comment (Corynebacterium aurimucosum ATCC 700975)
Sequence
MSAICQVTGRKPEFGKQVSHSHRRTSRRWNPNVQRRRYYLPSEGRTITLTVSTKGMKIID
RDGIESVVAKIRARGEKI
Download sequence
Identical sequences A0A0M2XLH3 A0A133ZJ08 A0A1E8ZMN3 A0A1E9ZUD9 A0A1F0VQ52 A0A1F1GK49 C3PF15
gi|227832650|ref|YP_002834357.1| WP_010187623.1.17100 WP_010187623.1.1812 WP_010187623.1.22213 WP_010187623.1.24814 WP_010187623.1.30941 WP_010187623.1.36044 WP_010187623.1.37396 WP_010187623.1.42612 WP_010187623.1.46034 WP_010187623.1.47967 WP_010187623.1.50226 WP_010187623.1.5085 WP_010187623.1.51129 WP_010187623.1.53176 WP_010187623.1.54459 WP_010187623.1.55422 WP_010187623.1.55572 WP_010187623.1.62413 WP_010187623.1.73378 WP_010187623.1.76843 WP_010187623.1.77435 WP_010187623.1.79390 WP_010187623.1.79579 WP_010187623.1.82492 WP_010187623.1.84091 WP_010187623.1.85403 WP_010187623.1.8910 WP_010187623.1.97074 169292.cauri_0822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]