SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 169292.cauri_1694 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  169292.cauri_1694
Domain Number 1 Region: 242-355
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.25e-36
Family NlpC/P60 0.0017
Further Details:      
 
Weak hits

Sequence:  169292.cauri_1694
Domain Number - Region: 53-147
Classification Level Classification E-value
Superfamily PhoU-like 0.0034
Family PhoU-like 0.02
Further Details:      
 
Domain Number - Region: 175-213
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0889
Family Myosin rod fragments 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 169292.cauri_1694
Sequence length 358
Comment (Corynebacterium aurimucosum ATCC 700975)
Sequence
MSRRGLACAVAALALSTVPVVVLSPSAVSQEVSPEQQQESAPQAQDPEDLSGLIERMADV
AQRVSAKGEEVKGLEDELAESEKNIEELDRKAEDAHRSSEDASAAVAAQQERIDALAQKR
YRRNAASTSVSAALNANDVASAVERMGYLGALSKAAKREEDAMIAASAAADDAHQEALDA
AEEARRKRDELQEQRDTVLKEKAELEEQQKELEATVDGLSPEAREAWVQHFGGSSDLDLA
ALADGSGSAAVEAALTRIGAPYGWGATGPDTFDCSGLMVWSYQQMGKSIPRTSQAQLAGG
TPVPMDQLEPGDIVGYYPGVTHVGMYIGDGQVVHASTYGVPVAVVPLNSMPVQGAVRY
Download sequence
Identical sequences C3PHI3
WP_010190570.1.1812 WP_010190570.1.84091 gi|227833518|ref|YP_002835225.1| 169292.cauri_1694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]