SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 169292.cauri_1794 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  169292.cauri_1794
Domain Number 1 Region: 32-244
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-26
Family Clostridium neurotoxins, the second last domain 0.092
Further Details:      
 
Domain Number 2 Region: 524-798
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1e-23
Family GpdQ-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 169292.cauri_1794
Sequence length 1098
Comment (Corynebacterium aurimucosum ATCC 700975)
Sequence
MSQKKSQKKLHKAALIASISLVGSSLVTPAIASAQDLPQADILDLSLENGTISNSASDAE
PLNIGAPTVEQDSVLERPVAHFDGRKDAVGFDIGDKFDQIKDGFTVECVFRYDGEFDGNE
KSLCANKEAGGWAMVIYGDQLTFTVNGSDGYKKAQQQVEPGQWYHAVGVYDGNKSELYVN
GAKVAENTEINGEVTKPKSNSTAVMIGADSGRDNAAQFYSDAVVSEARIFSDPLGEEEIS
ALYEDSNLSTDKKAEITGSTPSAGQHLTGPVTFDVQFNDDALISRELTYTLDGEEIEPGQ
EIGAGLKEGNHSIQAEGRDVFGNPISQAIDFTSGNLPGAAGTDSEPSGEGVTISARADNP
SGGEVETTFTEADVAVAEKGFQGTFTDIPESLDFEYEDGEDFDKALNPDNEDAQETSSTE
DMPFQRFDLKVKDAEKKAHDIAWSGTVDPKRSVRLMAWNTKSNTWEKLAETRGAADAEVS
LSAEVNQDFVDGGSIHTMLVGYDVFADDLNEPVNEQFADTSDYDFSIAHHTDTQYLSEGA
VEKATAEERKKWEESYTAATQWIADNADERKIAYSAHTGDIIENWIGKDNDRPNAKKEFE
VASNAQKILEDAGVVNGVLPGNHDNQSGADVGADNLYNEYFGPERYEAQQGKGKWAEQDA
SYHPYAEGDNDNHYDLFSTNGMDFIALHLGYDVTEEEAAWADKVLKQYSDRNAILLTHAY
LKPSASPDGRGSDFSHDGVMVYENVIQKNPNVALVLAGHEHGVSIVTRKDVGHTNNHVVE
LLADYQFYEVGSDELGLTEIGEYDGDTGLRFGSSYLRLLQFDLKNSEMIVDTYSPLLDDH
NATEYDDRQRYNGHEDEFRVPIQFQTRKTSFATNSMLALTDTGKEIGKDTAKSGWPASVT
YKDVKAGEAYGWYATSADASSKEGTKPGIVRQFGVFTAQEQQLEPDNKAPELTVPSNKLT
ITKGAEANLLEGVTAKDDKDGDLTDKVKVVGNIDTAKPGVYSVTYAVADSAGNQALASRV
VEVTAGNQGDNTDNGDSSSDSGNSSSSSSDNSSRGTGSVLPAILGALFGAAGATAVIAGL
LNYLAPEVRDTIKRALGL
Download sequence
Identical sequences C3PHT3
gi|227833618|ref|YP_002835325.1| 169292.cauri_1794 WP_010190747.1.1812 WP_010190747.1.84091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]