SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 169292.cauri_1995 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  169292.cauri_1995
Domain Number - Region: 49-109
Classification Level Classification E-value
Superfamily POZ domain 0.0573
Family Tetramerization domain of potassium channels 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 169292.cauri_1995
Sequence length 141
Comment (Corynebacterium aurimucosum ATCC 700975)
Sequence
MAIKKSPLWHSREEFRGLLADHETLNYLRSAEHMKLEICTLHLPPHLKRRVCDAADQWGI
ARNGMLIEIILGYLSSDTQYTPENRVVANTRTAEQTSFRLPSPAIDHMRWLADARGITIS
QLTADMIVEYFNNAETEDDAA
Download sequence
Identical sequences C3PID4
WP_010190974.1.1812 WP_010190974.1.84091 169292.cauri_1995 gi|227833819|ref|YP_002835526.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]