SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 169963.lmo1331 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  169963.lmo1331
Domain Number 1 Region: 296-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-47
Family Ribonuclease PH domain 1-like 0.0000121
Further Details:      
 
Domain Number 2 Region: 7-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.11e-46
Family Ribonuclease PH domain 1-like 0.0000226
Further Details:      
 
Domain Number 3 Region: 144-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.09e-30
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 4 Region: 452-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.63e-29
Family Ribonuclease PH domain 2-like 0.0000891
Further Details:      
 
Domain Number 5 Region: 608-696
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.45e-22
Family Cold shock DNA-binding domain-like 0.00038
Further Details:      
 
Domain Number 6 Region: 554-631
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.95e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 
Domain Number 7 Region: 238-322
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000000254
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 169963.lmo1331
Sequence length 723
Comment (Listeria monocytogenes)
Sequence
MSEKQVFSTEWAGKTLSVEVGQLAKQASGAALIRYGDTVVLTAAVGSKKPRPGDFFPLTV
NYEEKMYSVGKVPGGFLKREGRPSDRATLTARLIDRPIRPLFAEGFRNEVQITSTVFSVD
QDCSPEMAAMLGSSVALVISDIPFEGPIAGVDVGRIDGKYVINPTIEQAEKSDISLTVAG
TYDAINMVEAGAKEVSEEAMLEAIMFGHEEIKRLCEFQQQIIAAVGKEKREIELFVSDPE
LEAEVKAASEGKMKTAIKTEEKKAREAAIEEVKEEILESYKAKELENESEILSEVAHILE
MIEKDEMRRLISQDKIRPDGRKVNEIRPLSSEVGMLPRVHGSGLFTRGQTQALSVCTLAP
LREHQIIDGLGTEEYKRFMHHYNFPQFSVGETGPRRAPGRREIGHGALGERALQYVIPSE
EEFPYTIRLVSEVLESNGSSSQASICGSTLAMLDAGVPIKAPVAGIAMGLVKLGDDYTIL
SDIQGMEDHFGDMDFKVAGTKDGITALQMDIKIDGLSRQILDEALTQAKEGRLHILEHLT
STISAPREELSAYAPKIITLNIKPEKIKDVIGPGGKQINAIIDETGVKIDIEQDGTVYIA
SQDQAMNRKAIAIIEDIVREVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHER
VGKVEDILKLGDEVTVKVIEVDQQGRVNLSRKALLEKKEQPEGDKKPQAEKKFYPKTKKP
ESK
Download sequence
Identical sequences A0A1C7PUM4 A0A2G8Q495 A0A2G8QD44 A0A2G8QHY3 A0A2G8QV60 A0A2G8QZ52 Q8Y7F1
gi|284801716|ref|YP_003413581.1| gi|16803371|ref|NP_464856.1| gi|404283822|ref|YP_006684719.1| gi|284994858|ref|YP_003416626.1| gi|405758378|ref|YP_006687654.1| gi|386050307|ref|YP_005968298.1| gi|386053584|ref|YP_005971142.1| 169963.lmo1331 NP_464856.1.42710 WP_003722460.1.100045 WP_003722460.1.100147 WP_003722460.1.100229 WP_003722460.1.100510 WP_003722460.1.100530 WP_003722460.1.101144 WP_003722460.1.101354 WP_003722460.1.101368 WP_003722460.1.101752 WP_003722460.1.10198 WP_003722460.1.10484 WP_003722460.1.11177 WP_003722460.1.1123 WP_003722460.1.11266 WP_003722460.1.11313 WP_003722460.1.11326 WP_003722460.1.11419 WP_003722460.1.11686 WP_003722460.1.11712 WP_003722460.1.11779 WP_003722460.1.11851 WP_003722460.1.11907 WP_003722460.1.11976 WP_003722460.1.12037 WP_003722460.1.12143 WP_003722460.1.12377 WP_003722460.1.12824 WP_003722460.1.12988 WP_003722460.1.13052 WP_003722460.1.13134 WP_003722460.1.13160 WP_003722460.1.13304 WP_003722460.1.1336 WP_003722460.1.13695 WP_003722460.1.137 WP_003722460.1.13833 WP_003722460.1.1556 WP_003722460.1.1576 WP_003722460.1.16207 WP_003722460.1.16499 WP_003722460.1.1657 WP_003722460.1.16634 WP_003722460.1.17228 WP_003722460.1.17352 WP_003722460.1.17375 WP_003722460.1.17604 WP_003722460.1.1764 WP_003722460.1.17644 WP_003722460.1.17695 WP_003722460.1.178 WP_003722460.1.1794 WP_003722460.1.17947 WP_003722460.1.1803 WP_003722460.1.18222 WP_003722460.1.18576 WP_003722460.1.18648 WP_003722460.1.18689 WP_003722460.1.19080 WP_003722460.1.19189 WP_003722460.1.19409 WP_003722460.1.1947 WP_003722460.1.19548 WP_003722460.1.21046 WP_003722460.1.21133 WP_003722460.1.21705 WP_003722460.1.21884 WP_003722460.1.21926 WP_003722460.1.21995 WP_003722460.1.22154 WP_003722460.1.22190 WP_003722460.1.22202 WP_003722460.1.22434 WP_003722460.1.22656 WP_003722460.1.22962 WP_003722460.1.23193 WP_003722460.1.23254 WP_003722460.1.23582 WP_003722460.1.2368 WP_003722460.1.2422 WP_003722460.1.24349 WP_003722460.1.24370 WP_003722460.1.24546 WP_003722460.1.24651 WP_003722460.1.24818 WP_003722460.1.24836 WP_003722460.1.24945 WP_003722460.1.24972 WP_003722460.1.25020 WP_003722460.1.25057 WP_003722460.1.26052 WP_003722460.1.26060 WP_003722460.1.26145 WP_003722460.1.26146 WP_003722460.1.26320 WP_003722460.1.26350 WP_003722460.1.26406 WP_003722460.1.26523 WP_003722460.1.26632 WP_003722460.1.26891 WP_003722460.1.27200 WP_003722460.1.27231 WP_003722460.1.27281 WP_003722460.1.27839 WP_003722460.1.28062 WP_003722460.1.28123 WP_003722460.1.28297 WP_003722460.1.28325 WP_003722460.1.28402 WP_003722460.1.28747 WP_003722460.1.28803 WP_003722460.1.2920 WP_003722460.1.29550 WP_003722460.1.29705 WP_003722460.1.29723 WP_003722460.1.29738 WP_003722460.1.29872 WP_003722460.1.29912 WP_003722460.1.30193 WP_003722460.1.30227 WP_003722460.1.30267 WP_003722460.1.305 WP_003722460.1.30827 WP_003722460.1.30882 WP_003722460.1.30902 WP_003722460.1.31108 WP_003722460.1.31444 WP_003722460.1.31485 WP_003722460.1.31584 WP_003722460.1.31830 WP_003722460.1.32209 WP_003722460.1.32210 WP_003722460.1.32278 WP_003722460.1.32472 WP_003722460.1.32622 WP_003722460.1.3324 WP_003722460.1.33336 WP_003722460.1.33688 WP_003722460.1.337 WP_003722460.1.33875 WP_003722460.1.33995 WP_003722460.1.34326 WP_003722460.1.34732 WP_003722460.1.34849 WP_003722460.1.34851 WP_003722460.1.350 WP_003722460.1.35135 WP_003722460.1.35450 WP_003722460.1.36181 WP_003722460.1.364 WP_003722460.1.36599 WP_003722460.1.36877 WP_003722460.1.37278 WP_003722460.1.37518 WP_003722460.1.37561 WP_003722460.1.3782 WP_003722460.1.37882 WP_003722460.1.38025 WP_003722460.1.38076 WP_003722460.1.38150 WP_003722460.1.3853 WP_003722460.1.38733 WP_003722460.1.38792 WP_003722460.1.38800 WP_003722460.1.38833 WP_003722460.1.39115 WP_003722460.1.3919 WP_003722460.1.39262 WP_003722460.1.39351 WP_003722460.1.39554 WP_003722460.1.3959 WP_003722460.1.39887 WP_003722460.1.40263 WP_003722460.1.405 WP_003722460.1.40720 WP_003722460.1.40820 WP_003722460.1.40976 WP_003722460.1.41281 WP_003722460.1.41909 WP_003722460.1.4218 WP_003722460.1.42615 WP_003722460.1.42672 WP_003722460.1.42958 WP_003722460.1.43280 WP_003722460.1.43327 WP_003722460.1.43619 WP_003722460.1.4371 WP_003722460.1.44023 WP_003722460.1.44106 WP_003722460.1.4479 WP_003722460.1.44897 WP_003722460.1.44924 WP_003722460.1.45295 WP_003722460.1.45309 WP_003722460.1.45524 WP_003722460.1.45758 WP_003722460.1.45877 WP_003722460.1.45983 WP_003722460.1.45994 WP_003722460.1.4604 WP_003722460.1.46045 WP_003722460.1.46314 WP_003722460.1.46863 WP_003722460.1.46883 WP_003722460.1.47055 WP_003722460.1.47412 WP_003722460.1.47738 WP_003722460.1.48358 WP_003722460.1.48471 WP_003722460.1.48624 WP_003722460.1.48661 WP_003722460.1.48999 WP_003722460.1.49146 WP_003722460.1.49202 WP_003722460.1.49205 WP_003722460.1.49415 WP_003722460.1.49604 WP_003722460.1.49952 WP_003722460.1.49962 WP_003722460.1.5020 WP_003722460.1.50236 WP_003722460.1.50237 WP_003722460.1.50243 WP_003722460.1.50334 WP_003722460.1.50883 WP_003722460.1.50888 WP_003722460.1.50926 WP_003722460.1.50971 WP_003722460.1.51318 WP_003722460.1.51435 WP_003722460.1.51732 WP_003722460.1.52177 WP_003722460.1.52395 WP_003722460.1.52447 WP_003722460.1.52617 WP_003722460.1.52684 WP_003722460.1.52867 WP_003722460.1.52989 WP_003722460.1.53266 WP_003722460.1.53378 WP_003722460.1.53807 WP_003722460.1.54046 WP_003722460.1.54155 WP_003722460.1.54160 WP_003722460.1.5417 WP_003722460.1.54181 WP_003722460.1.54564 WP_003722460.1.54639 WP_003722460.1.54646 WP_003722460.1.54890 WP_003722460.1.55231 WP_003722460.1.55238 WP_003722460.1.55487 WP_003722460.1.55683 WP_003722460.1.55740 WP_003722460.1.55797 WP_003722460.1.55847 WP_003722460.1.5601 WP_003722460.1.56415 WP_003722460.1.56526 WP_003722460.1.56557 WP_003722460.1.56759 WP_003722460.1.56923 WP_003722460.1.57132 WP_003722460.1.57171 WP_003722460.1.57504 WP_003722460.1.57505 WP_003722460.1.57625 WP_003722460.1.57766 WP_003722460.1.57963 WP_003722460.1.57979 WP_003722460.1.58069 WP_003722460.1.58088 WP_003722460.1.58177 WP_003722460.1.58532 WP_003722460.1.58661 WP_003722460.1.59045 WP_003722460.1.59343 WP_003722460.1.59477 WP_003722460.1.59571 WP_003722460.1.5973 WP_003722460.1.59799 WP_003722460.1.59937 WP_003722460.1.59949 WP_003722460.1.59984 WP_003722460.1.60166 WP_003722460.1.60219 WP_003722460.1.60258 WP_003722460.1.60346 WP_003722460.1.60369 WP_003722460.1.60665 WP_003722460.1.60956 WP_003722460.1.61002 WP_003722460.1.61109 WP_003722460.1.61244 WP_003722460.1.61894 WP_003722460.1.62430 WP_003722460.1.62629 WP_003722460.1.62663 WP_003722460.1.62852 WP_003722460.1.62904 WP_003722460.1.62972 WP_003722460.1.63359 WP_003722460.1.63951 WP_003722460.1.6397 WP_003722460.1.64041 WP_003722460.1.64200 WP_003722460.1.64227 WP_003722460.1.64259 WP_003722460.1.6460 WP_003722460.1.648 WP_003722460.1.65094 WP_003722460.1.65213 WP_003722460.1.65376 WP_003722460.1.65730 WP_003722460.1.6579 WP_003722460.1.65827 WP_003722460.1.65840 WP_003722460.1.65913 WP_003722460.1.66005 WP_003722460.1.66039 WP_003722460.1.66184 WP_003722460.1.66311 WP_003722460.1.66338 WP_003722460.1.66512 WP_003722460.1.66884 WP_003722460.1.67165 WP_003722460.1.67301 WP_003722460.1.67408 WP_003722460.1.67610 WP_003722460.1.67709 WP_003722460.1.67795 WP_003722460.1.67884 WP_003722460.1.68112 WP_003722460.1.68123 WP_003722460.1.68197 WP_003722460.1.68301 WP_003722460.1.68321 WP_003722460.1.68414 WP_003722460.1.68528 WP_003722460.1.69190 WP_003722460.1.69265 WP_003722460.1.69471 WP_003722460.1.69570 WP_003722460.1.69631 WP_003722460.1.69727 WP_003722460.1.70309 WP_003722460.1.7051 WP_003722460.1.70690 WP_003722460.1.70992 WP_003722460.1.71468 WP_003722460.1.71753 WP_003722460.1.71921 WP_003722460.1.72051 WP_003722460.1.72057 WP_003722460.1.72116 WP_003722460.1.72228 WP_003722460.1.72385 WP_003722460.1.72566 WP_003722460.1.72636 WP_003722460.1.72841 WP_003722460.1.734 WP_003722460.1.73656 WP_003722460.1.74217 WP_003722460.1.74290 WP_003722460.1.74351 WP_003722460.1.74450 WP_003722460.1.7454 WP_003722460.1.74572 WP_003722460.1.74754 WP_003722460.1.74837 WP_003722460.1.7498 WP_003722460.1.75069 WP_003722460.1.75240 WP_003722460.1.75541 WP_003722460.1.75604 WP_003722460.1.75624 WP_003722460.1.75670 WP_003722460.1.76124 WP_003722460.1.76769 WP_003722460.1.77116 WP_003722460.1.77149 WP_003722460.1.77192 WP_003722460.1.77246 WP_003722460.1.77350 WP_003722460.1.7736 WP_003722460.1.77376 WP_003722460.1.77420 WP_003722460.1.77681 WP_003722460.1.77823 WP_003722460.1.78121 WP_003722460.1.78167 WP_003722460.1.78203 WP_003722460.1.7832 WP_003722460.1.78336 WP_003722460.1.78525 WP_003722460.1.79184 WP_003722460.1.79212 WP_003722460.1.7932 WP_003722460.1.79351 WP_003722460.1.79434 WP_003722460.1.79458 WP_003722460.1.79630 WP_003722460.1.79803 WP_003722460.1.79964 WP_003722460.1.80028 WP_003722460.1.80036 WP_003722460.1.80105 WP_003722460.1.80790 WP_003722460.1.81261 WP_003722460.1.81503 WP_003722460.1.81662 WP_003722460.1.81713 WP_003722460.1.82274 WP_003722460.1.82440 WP_003722460.1.82667 WP_003722460.1.82719 WP_003722460.1.82893 WP_003722460.1.83030 WP_003722460.1.83121 WP_003722460.1.83137 WP_003722460.1.83215 WP_003722460.1.83260 WP_003722460.1.83323 WP_003722460.1.83478 WP_003722460.1.83542 WP_003722460.1.83546 WP_003722460.1.83932 WP_003722460.1.8418 WP_003722460.1.84265 WP_003722460.1.84320 WP_003722460.1.84539 WP_003722460.1.84579 WP_003722460.1.84586 WP_003722460.1.8460 WP_003722460.1.8473 WP_003722460.1.84781 WP_003722460.1.84833 WP_003722460.1.84980 WP_003722460.1.85037 WP_003722460.1.85203 WP_003722460.1.8593 WP_003722460.1.86091 WP_003722460.1.86253 WP_003722460.1.86308 WP_003722460.1.86484 WP_003722460.1.86597 WP_003722460.1.866 WP_003722460.1.86958 WP_003722460.1.87085 WP_003722460.1.8710 WP_003722460.1.87108 WP_003722460.1.87536 WP_003722460.1.87701 WP_003722460.1.87794 WP_003722460.1.8782 WP_003722460.1.87920 WP_003722460.1.88015 WP_003722460.1.88063 WP_003722460.1.88112 WP_003722460.1.88128 WP_003722460.1.88485 WP_003722460.1.88584 WP_003722460.1.89085 WP_003722460.1.89160 WP_003722460.1.89386 WP_003722460.1.89443 WP_003722460.1.89450 WP_003722460.1.89478 WP_003722460.1.89809 WP_003722460.1.8988 WP_003722460.1.90086 WP_003722460.1.9019 WP_003722460.1.90201 WP_003722460.1.90821 WP_003722460.1.90829 WP_003722460.1.9109 WP_003722460.1.91168 WP_003722460.1.91514 WP_003722460.1.91556 WP_003722460.1.91765 WP_003722460.1.92132 WP_003722460.1.92148 WP_003722460.1.92274 WP_003722460.1.92370 WP_003722460.1.92409 WP_003722460.1.93556 WP_003722460.1.93777 WP_003722460.1.93859 WP_003722460.1.93895 WP_003722460.1.93920 WP_003722460.1.94032 WP_003722460.1.94058 WP_003722460.1.94758 WP_003722460.1.94961 WP_003722460.1.95162 WP_003722460.1.95186 WP_003722460.1.95702 WP_003722460.1.95945 WP_003722460.1.96033 WP_003722460.1.96140 WP_003722460.1.9643 WP_003722460.1.96586 WP_003722460.1.9672 WP_003722460.1.96940 WP_003722460.1.97165 WP_003722460.1.97199 WP_003722460.1.97203 WP_003722460.1.9732 WP_003722460.1.97390 WP_003722460.1.97633 WP_003722460.1.97752 WP_003722460.1.97820 WP_003722460.1.98038 WP_003722460.1.98060 WP_003722460.1.98193 WP_003722460.1.98331 WP_003722460.1.9894 WP_003722460.1.99026 WP_003722460.1.9916 WP_003722460.1.99409 WP_003722460.1.99480 WP_003722460.1.99512 WP_003722460.1.99520 WP_003722460.1.99527 WP_003722460.1.99785 WP_003722460.1.99786 WP_003722460.1.99914 WP_003722460.1.99974 gi|386046983|ref|YP_005965315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]