SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 170187.SP_1326 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  170187.SP_1326
Domain Number 1 Region: 280-404,499-719
Classification Level Classification E-value
Superfamily Sialidases 2.03e-60
Family Sialidases (neuraminidases) 0.000000231
Further Details:      
 
Domain Number 2 Region: 109-267
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.05e-28
Family Leech intramolecular trans-sialidase, N-terminal domain 0.0000962
Further Details:      
 
Weak hits

Sequence:  170187.SP_1326
Domain Number - Region: 412-459
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 0.0647
Family N-acetylmuramoyl-L-alanine amidase-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 170187.SP_1326
Sequence length 740
Comment (Streptococcus pneumoniae TIGR4)
Sequence
MKKNIKQYVTLGTVVVLSAFVANSVAAQETETSEVSTPKLVQPVAPTTPISEVQPTSDNS
SEVTVQPRTVETTVKDPSSTAEETPVLEKNNVTLTGGGENVTKELKDKFTSGDFTVVIKY
NQSSEKGLQALFGISNSKPGQQNSYVDVFLRDNGELGMEARDTSSNKNNLVSRPASVWGK
YKQEAVTNTVAVVADSVKKTYSLYANGTKVVEKKVDNFLNIKDIKGIDYYMLGGVKRAGK
TAFGFNGTLENIKFFNSALDEETVKKMTTNAVTGHLIYTANDTTGSNYFRIPVLYTFSNG
RVFSSIDARYGGTHDFLNKINIATSYSDDNGKTWTKPKLTLAFDDFAPVPLEWPREVGGR
DLQISGGATYIDSVIVEKKNKQVLMFADVMPAGVSFREATRKDSGYKQIDGNYYLKLRKQ
GDTDYNYTIRENGTVYDDRTNRPTEFSVDKNFGIKQNGNYLTVEQYSVSFENNKKTEYRN
GTKVHMNIFYKDALFKVVPTNYIAYISSNDHGESWSAPTLLPPIMGLNRNAPYLGPGRGI
IESSTGRILIPSYTGKESAFIYSDDNGASWKVKVVPLPSSWSAEAQFVELSPGVIQAYMR
TNNGKIAYLTSKDAGTTWSAPEYLKFVSNPSYGTQLSIINYSQLIDGKKAVILSTPNSTN
GRKHGQIWIGLINDDNTIDWRYHHDVDYSNYGYSYSTLTELPNHEIGLMFEKFDSWSRNE
LHMKNVVPYITFKIEDLKKN
Download sequence
Identical sequences A0A0B7LH44 A0A0H2UQE4 B1ICD8
gi|15901180|ref|NP_345784.1| 170187.SP_1326 487214.SPH_1468 512566.SPG_1219 WP_000739360.1.1 WP_000739360.1.100026 WP_000739360.1.10009 WP_000739360.1.100109 WP_000739360.1.100158 WP_000739360.1.10016 WP_000739360.1.100192 WP_000739360.1.10020 WP_000739360.1.100201 WP_000739360.1.100240 WP_000739360.1.10035 WP_000739360.1.100364 WP_000739360.1.10049 WP_000739360.1.1006 WP_000739360.1.100629 WP_000739360.1.100745 WP_000739360.1.100756 WP_000739360.1.100805 WP_000739360.1.100816 WP_000739360.1.100897 WP_000739360.1.100940 WP_000739360.1.101062 WP_000739360.1.101080 WP_000739360.1.101178 WP_000739360.1.101181 WP_000739360.1.101232 WP_000739360.1.101369 WP_000739360.1.101407 WP_000739360.1.101494 WP_000739360.1.101685 WP_000739360.1.101789 WP_000739360.1.101790 WP_000739360.1.10196 WP_000739360.1.102077 WP_000739360.1.102091 WP_000739360.1.1026 WP_000739360.1.10295 WP_000739360.1.10337 WP_000739360.1.10391 WP_000739360.1.10613 WP_000739360.1.10713 WP_000739360.1.1076 WP_000739360.1.10766 WP_000739360.1.10900 WP_000739360.1.10914 WP_000739360.1.10951 WP_000739360.1.11103 WP_000739360.1.11120 WP_000739360.1.11131 WP_000739360.1.11298 WP_000739360.1.11358 WP_000739360.1.11510 WP_000739360.1.11619 WP_000739360.1.11811 WP_000739360.1.11861 WP_000739360.1.12024 WP_000739360.1.12084 WP_000739360.1.12134 WP_000739360.1.12140 WP_000739360.1.12182 WP_000739360.1.12214 WP_000739360.1.12383 WP_000739360.1.12428 WP_000739360.1.1243 WP_000739360.1.12435 WP_000739360.1.12470 WP_000739360.1.12487 WP_000739360.1.12538 WP_000739360.1.12587 WP_000739360.1.12595 WP_000739360.1.12723 WP_000739360.1.128 WP_000739360.1.12948 WP_000739360.1.12996 WP_000739360.1.13000 WP_000739360.1.13048 WP_000739360.1.13187 WP_000739360.1.13256 WP_000739360.1.13257 WP_000739360.1.13286 WP_000739360.1.1329 WP_000739360.1.13351 WP_000739360.1.13382 WP_000739360.1.13388 WP_000739360.1.13515 WP_000739360.1.13560 WP_000739360.1.13653 WP_000739360.1.13701 WP_000739360.1.1371 WP_000739360.1.13729 WP_000739360.1.1391 WP_000739360.1.14012 WP_000739360.1.14066 WP_000739360.1.14106 WP_000739360.1.14132 WP_000739360.1.14206 WP_000739360.1.14211 WP_000739360.1.14254 WP_000739360.1.14260 WP_000739360.1.14291 WP_000739360.1.14294 WP_000739360.1.14347 WP_000739360.1.14408 WP_000739360.1.14435 WP_000739360.1.14440 WP_000739360.1.1449 WP_000739360.1.145 WP_000739360.1.14682 WP_000739360.1.14740 WP_000739360.1.14780 WP_000739360.1.14899 WP_000739360.1.14949 WP_000739360.1.15026 WP_000739360.1.15058 WP_000739360.1.15086 WP_000739360.1.15106 WP_000739360.1.15135 WP_000739360.1.15149 WP_000739360.1.1515 WP_000739360.1.1522 WP_000739360.1.15305 WP_000739360.1.15344 WP_000739360.1.15552 WP_000739360.1.15596 WP_000739360.1.15607 WP_000739360.1.15635 WP_000739360.1.15639 WP_000739360.1.15661 WP_000739360.1.15670 WP_000739360.1.15788 WP_000739360.1.15854 WP_000739360.1.1590 WP_000739360.1.15900 WP_000739360.1.15967 WP_000739360.1.16053 WP_000739360.1.16056 WP_000739360.1.16081 WP_000739360.1.16101 WP_000739360.1.16218 WP_000739360.1.16323 WP_000739360.1.16337 WP_000739360.1.16357 WP_000739360.1.16381 WP_000739360.1.16514 WP_000739360.1.16550 WP_000739360.1.16568 WP_000739360.1.16570 WP_000739360.1.16803 WP_000739360.1.16849 WP_000739360.1.16884 WP_000739360.1.16952 WP_000739360.1.16955 WP_000739360.1.16974 WP_000739360.1.17029 WP_000739360.1.17063 WP_000739360.1.1724 WP_000739360.1.17254 WP_000739360.1.17269 WP_000739360.1.17286 WP_000739360.1.17291 WP_000739360.1.17315 WP_000739360.1.17340 WP_000739360.1.17472 WP_000739360.1.17474 WP_000739360.1.17532 WP_000739360.1.17652 WP_000739360.1.17688 WP_000739360.1.17826 WP_000739360.1.17854 WP_000739360.1.17888 WP_000739360.1.17892 WP_000739360.1.17917 WP_000739360.1.18147 WP_000739360.1.18285 WP_000739360.1.18342 WP_000739360.1.1846 WP_000739360.1.1848 WP_000739360.1.18488 WP_000739360.1.18496 WP_000739360.1.18555 WP_000739360.1.18571 WP_000739360.1.18630 WP_000739360.1.18670 WP_000739360.1.18712 WP_000739360.1.18768 WP_000739360.1.18770 WP_000739360.1.18928 WP_000739360.1.19172 WP_000739360.1.19218 WP_000739360.1.19239 WP_000739360.1.19359 WP_000739360.1.19383 WP_000739360.1.19385 WP_000739360.1.19530 WP_000739360.1.19698 WP_000739360.1.19998 WP_000739360.1.20008 WP_000739360.1.2017 WP_000739360.1.20207 WP_000739360.1.20298 WP_000739360.1.20374 WP_000739360.1.20491 WP_000739360.1.20505 WP_000739360.1.20634 WP_000739360.1.207 WP_000739360.1.20899 WP_000739360.1.20915 WP_000739360.1.20934 WP_000739360.1.20936 WP_000739360.1.20981 WP_000739360.1.20984 WP_000739360.1.20988 WP_000739360.1.21090 WP_000739360.1.21230 WP_000739360.1.21244 WP_000739360.1.21377 WP_000739360.1.21422 WP_000739360.1.21433 WP_000739360.1.21436 WP_000739360.1.2148 WP_000739360.1.21612 WP_000739360.1.2167 WP_000739360.1.2173 WP_000739360.1.21781 WP_000739360.1.21788 WP_000739360.1.21790 WP_000739360.1.21807 WP_000739360.1.21838 WP_000739360.1.21904 WP_000739360.1.21979 WP_000739360.1.2202 WP_000739360.1.2203 WP_000739360.1.22043 WP_000739360.1.22186 WP_000739360.1.22196 WP_000739360.1.22297 WP_000739360.1.22459 WP_000739360.1.22506 WP_000739360.1.22550 WP_000739360.1.22561 WP_000739360.1.22591 WP_000739360.1.2260 WP_000739360.1.2263 WP_000739360.1.22761 WP_000739360.1.22839 WP_000739360.1.22904 WP_000739360.1.22941 WP_000739360.1.2296 WP_000739360.1.23025 WP_000739360.1.23076 WP_000739360.1.23097 WP_000739360.1.2319 WP_000739360.1.23334 WP_000739360.1.23354 WP_000739360.1.23432 WP_000739360.1.23606 WP_000739360.1.23668 WP_000739360.1.23770 WP_000739360.1.23798 WP_000739360.1.23916 WP_000739360.1.23966 WP_000739360.1.23978 WP_000739360.1.24010 WP_000739360.1.24060 WP_000739360.1.24067 WP_000739360.1.24085 WP_000739360.1.24098 WP_000739360.1.24146 WP_000739360.1.2429 WP_000739360.1.243 WP_000739360.1.2444 WP_000739360.1.24466 WP_000739360.1.2461 WP_000739360.1.24649 WP_000739360.1.24724 WP_000739360.1.24852 WP_000739360.1.24871 WP_000739360.1.24989 WP_000739360.1.2503 WP_000739360.1.25106 WP_000739360.1.25121 WP_000739360.1.25124 WP_000739360.1.25244 WP_000739360.1.25442 WP_000739360.1.25589 WP_000739360.1.25685 WP_000739360.1.25707 WP_000739360.1.2573 WP_000739360.1.25785 WP_000739360.1.25791 WP_000739360.1.25982 WP_000739360.1.26062 WP_000739360.1.26165 WP_000739360.1.26317 WP_000739360.1.26432 WP_000739360.1.26490 WP_000739360.1.26578 WP_000739360.1.26698 WP_000739360.1.26807 WP_000739360.1.26877 WP_000739360.1.26900 WP_000739360.1.26925 WP_000739360.1.27046 WP_000739360.1.27078 WP_000739360.1.2724 WP_000739360.1.27289 WP_000739360.1.2729 WP_000739360.1.27347 WP_000739360.1.27440 WP_000739360.1.27636 WP_000739360.1.27887 WP_000739360.1.2791 WP_000739360.1.280 WP_000739360.1.28264 WP_000739360.1.28307 WP_000739360.1.28353 WP_000739360.1.28522 WP_000739360.1.28542 WP_000739360.1.28608 WP_000739360.1.2868 WP_000739360.1.28708 WP_000739360.1.28709 WP_000739360.1.28767 WP_000739360.1.28772 WP_000739360.1.28816 WP_000739360.1.28868 WP_000739360.1.28869 WP_000739360.1.2888 WP_000739360.1.28931 WP_000739360.1.29039 WP_000739360.1.29104 WP_000739360.1.29192 WP_000739360.1.29232 WP_000739360.1.29284 WP_000739360.1.29357 WP_000739360.1.2940 WP_000739360.1.29473 WP_000739360.1.29572 WP_000739360.1.29628 WP_000739360.1.29653 WP_000739360.1.29751 WP_000739360.1.29828 WP_000739360.1.29868 WP_000739360.1.29881 WP_000739360.1.29944 WP_000739360.1.30011 WP_000739360.1.30066 WP_000739360.1.30119 WP_000739360.1.30167 WP_000739360.1.30219 WP_000739360.1.30243 WP_000739360.1.30255 WP_000739360.1.30287 WP_000739360.1.30295 WP_000739360.1.30342 WP_000739360.1.3040 WP_000739360.1.30406 WP_000739360.1.30480 WP_000739360.1.30564 WP_000739360.1.30588 WP_000739360.1.30612 WP_000739360.1.30672 WP_000739360.1.30676 WP_000739360.1.30757 WP_000739360.1.30942 WP_000739360.1.30959 WP_000739360.1.31099 WP_000739360.1.31169 WP_000739360.1.31256 WP_000739360.1.31283 WP_000739360.1.31439 WP_000739360.1.31464 WP_000739360.1.31522 WP_000739360.1.31545 WP_000739360.1.31550 WP_000739360.1.31566 WP_000739360.1.31574 WP_000739360.1.31620 WP_000739360.1.3178 WP_000739360.1.31780 WP_000739360.1.31876 WP_000739360.1.31887 WP_000739360.1.31929 WP_000739360.1.31989 WP_000739360.1.32083 WP_000739360.1.3211 WP_000739360.1.32334 WP_000739360.1.32485 WP_000739360.1.32642 WP_000739360.1.32771 WP_000739360.1.32820 WP_000739360.1.32876 WP_000739360.1.32906 WP_000739360.1.33091 WP_000739360.1.33166 WP_000739360.1.33451 WP_000739360.1.33528 WP_000739360.1.33589 WP_000739360.1.3359 WP_000739360.1.33727 WP_000739360.1.33758 WP_000739360.1.33788 WP_000739360.1.33874 WP_000739360.1.33878 WP_000739360.1.33891 WP_000739360.1.33933 WP_000739360.1.33950 WP_000739360.1.34015 WP_000739360.1.34085 WP_000739360.1.34262 WP_000739360.1.34327 WP_000739360.1.34449 WP_000739360.1.34616 WP_000739360.1.34644 WP_000739360.1.34662 WP_000739360.1.34713 WP_000739360.1.34754 WP_000739360.1.34776 WP_000739360.1.34787 WP_000739360.1.3496 WP_000739360.1.35217 WP_000739360.1.35218 WP_000739360.1.35251 WP_000739360.1.35290 WP_000739360.1.35305 WP_000739360.1.35383 WP_000739360.1.35392 WP_000739360.1.35432 WP_000739360.1.35458 WP_000739360.1.35501 WP_000739360.1.35678 WP_000739360.1.35702 WP_000739360.1.3571 WP_000739360.1.35735 WP_000739360.1.35920 WP_000739360.1.35932 WP_000739360.1.36060 WP_000739360.1.36162 WP_000739360.1.3621 WP_000739360.1.36351 WP_000739360.1.36448 WP_000739360.1.36486 WP_000739360.1.36568 WP_000739360.1.36641 WP_000739360.1.36651 WP_000739360.1.36653 WP_000739360.1.36732 WP_000739360.1.3674 WP_000739360.1.36789 WP_000739360.1.36982 WP_000739360.1.36993 WP_000739360.1.37118 WP_000739360.1.37136 WP_000739360.1.37164 WP_000739360.1.37194 WP_000739360.1.37357 WP_000739360.1.37415 WP_000739360.1.37511 WP_000739360.1.37623 WP_000739360.1.3763 WP_000739360.1.37707 WP_000739360.1.37713 WP_000739360.1.38014 WP_000739360.1.38073 WP_000739360.1.38288 WP_000739360.1.38378 WP_000739360.1.38519 WP_000739360.1.38588 WP_000739360.1.3864 WP_000739360.1.38695 WP_000739360.1.38718 WP_000739360.1.38742 WP_000739360.1.3876 WP_000739360.1.38770 WP_000739360.1.3883 WP_000739360.1.38860 WP_000739360.1.38861 WP_000739360.1.38868 WP_000739360.1.38955 WP_000739360.1.38969 WP_000739360.1.39071 WP_000739360.1.39083 WP_000739360.1.39097 WP_000739360.1.39124 WP_000739360.1.39189 WP_000739360.1.39227 WP_000739360.1.3928 WP_000739360.1.39318 WP_000739360.1.39511 WP_000739360.1.39518 WP_000739360.1.39558 WP_000739360.1.39824 WP_000739360.1.39931 WP_000739360.1.40216 WP_000739360.1.40479 WP_000739360.1.40526 WP_000739360.1.40728 WP_000739360.1.40736 WP_000739360.1.40737 WP_000739360.1.40746 WP_000739360.1.40754 WP_000739360.1.40826 WP_000739360.1.40931 WP_000739360.1.4094 WP_000739360.1.40977 WP_000739360.1.41008 WP_000739360.1.41012 WP_000739360.1.41047 WP_000739360.1.41088 WP_000739360.1.41278 WP_000739360.1.4128 WP_000739360.1.41327 WP_000739360.1.41467 WP_000739360.1.41508 WP_000739360.1.41652 WP_000739360.1.41673 WP_000739360.1.41697 WP_000739360.1.41823 WP_000739360.1.41827 WP_000739360.1.41892 WP_000739360.1.41958 WP_000739360.1.41961 WP_000739360.1.42149 WP_000739360.1.42291 WP_000739360.1.42358 WP_000739360.1.42625 WP_000739360.1.42642 WP_000739360.1.42873 WP_000739360.1.42935 WP_000739360.1.43044 WP_000739360.1.43207 WP_000739360.1.43294 WP_000739360.1.43302 WP_000739360.1.43344 WP_000739360.1.43503 WP_000739360.1.43580 WP_000739360.1.43634 WP_000739360.1.4364 WP_000739360.1.4366 WP_000739360.1.43698 WP_000739360.1.43714 WP_000739360.1.43771 WP_000739360.1.43889 WP_000739360.1.44073 WP_000739360.1.4409 WP_000739360.1.44138 WP_000739360.1.44156 WP_000739360.1.44379 WP_000739360.1.44387 WP_000739360.1.44403 WP_000739360.1.44421 WP_000739360.1.44462 WP_000739360.1.44512 WP_000739360.1.44533 WP_000739360.1.44647 WP_000739360.1.44789 WP_000739360.1.44850 WP_000739360.1.44872 WP_000739360.1.44938 WP_000739360.1.44987 WP_000739360.1.44995 WP_000739360.1.45023 WP_000739360.1.45078 WP_000739360.1.4512 WP_000739360.1.45179 WP_000739360.1.45224 WP_000739360.1.45263 WP_000739360.1.45346 WP_000739360.1.45417 WP_000739360.1.4556 WP_000739360.1.45601 WP_000739360.1.45673 WP_000739360.1.45691 WP_000739360.1.45753 WP_000739360.1.45820 WP_000739360.1.45886 WP_000739360.1.46022 WP_000739360.1.46024 WP_000739360.1.46060 WP_000739360.1.4621 WP_000739360.1.46281 WP_000739360.1.46284 WP_000739360.1.46501 WP_000739360.1.46571 WP_000739360.1.46694 WP_000739360.1.46884 WP_000739360.1.47045 WP_000739360.1.47076 WP_000739360.1.47180 WP_000739360.1.47288 WP_000739360.1.47596 WP_000739360.1.47651 WP_000739360.1.47657 WP_000739360.1.47712 WP_000739360.1.47771 WP_000739360.1.47987 WP_000739360.1.48118 WP_000739360.1.48171 WP_000739360.1.48339 WP_000739360.1.48395 WP_000739360.1.48447 WP_000739360.1.48582 WP_000739360.1.48604 WP_000739360.1.48614 WP_000739360.1.48731 WP_000739360.1.48799 WP_000739360.1.4882 WP_000739360.1.49008 WP_000739360.1.49038 WP_000739360.1.49165 WP_000739360.1.49216 WP_000739360.1.49232 WP_000739360.1.49538 WP_000739360.1.49635 WP_000739360.1.49824 WP_000739360.1.49840 WP_000739360.1.49874 WP_000739360.1.49964 WP_000739360.1.5000 WP_000739360.1.50000 WP_000739360.1.50070 WP_000739360.1.50120 WP_000739360.1.502 WP_000739360.1.50259 WP_000739360.1.50296 WP_000739360.1.50305 WP_000739360.1.50315 WP_000739360.1.50436 WP_000739360.1.50501 WP_000739360.1.50603 WP_000739360.1.50604 WP_000739360.1.50628 WP_000739360.1.50649 WP_000739360.1.50664 WP_000739360.1.50764 WP_000739360.1.50948 WP_000739360.1.51075 WP_000739360.1.51083 WP_000739360.1.51096 WP_000739360.1.51113 WP_000739360.1.51210 WP_000739360.1.51241 WP_000739360.1.51316 WP_000739360.1.51420 WP_000739360.1.51439 WP_000739360.1.51444 WP_000739360.1.51533 WP_000739360.1.51626 WP_000739360.1.51774 WP_000739360.1.51826 WP_000739360.1.51835 WP_000739360.1.51908 WP_000739360.1.5191 WP_000739360.1.51947 WP_000739360.1.5196 WP_000739360.1.52064 WP_000739360.1.5212 WP_000739360.1.52263 WP_000739360.1.52386 WP_000739360.1.5244 WP_000739360.1.52600 WP_000739360.1.52786 WP_000739360.1.52842 WP_000739360.1.52856 WP_000739360.1.52862 WP_000739360.1.52972 WP_000739360.1.5298 WP_000739360.1.53042 WP_000739360.1.53054 WP_000739360.1.53068 WP_000739360.1.53129 WP_000739360.1.53295 WP_000739360.1.53404 WP_000739360.1.53420 WP_000739360.1.53430 WP_000739360.1.53440 WP_000739360.1.53600 WP_000739360.1.5361 WP_000739360.1.53640 WP_000739360.1.53677 WP_000739360.1.53773 WP_000739360.1.53820 WP_000739360.1.5396 WP_000739360.1.54041 WP_000739360.1.54130 WP_000739360.1.54157 WP_000739360.1.54231 WP_000739360.1.54235 WP_000739360.1.5424 WP_000739360.1.543 WP_000739360.1.5431 WP_000739360.1.54349 WP_000739360.1.54458 WP_000739360.1.54563 WP_000739360.1.54738 WP_000739360.1.54810 WP_000739360.1.54840 WP_000739360.1.54862 WP_000739360.1.54872 WP_000739360.1.54971 WP_000739360.1.55079 WP_000739360.1.55091 WP_000739360.1.55093 WP_000739360.1.55211 WP_000739360.1.55217 WP_000739360.1.55244 WP_000739360.1.5528 WP_000739360.1.5537 WP_000739360.1.55377 WP_000739360.1.55404 WP_000739360.1.55409 WP_000739360.1.55432 WP_000739360.1.55479 WP_000739360.1.55499 WP_000739360.1.55525 WP_000739360.1.55531 WP_000739360.1.55587 WP_000739360.1.55589 WP_000739360.1.55605 WP_000739360.1.55685 WP_000739360.1.55761 WP_000739360.1.5578 WP_000739360.1.55810 WP_000739360.1.5599 WP_000739360.1.56062 WP_000739360.1.56250 WP_000739360.1.56251 WP_000739360.1.56288 WP_000739360.1.56300 WP_000739360.1.56382 WP_000739360.1.56472 WP_000739360.1.56518 WP_000739360.1.56519 WP_000739360.1.56568 WP_000739360.1.56581 WP_000739360.1.56582 WP_000739360.1.56617 WP_000739360.1.56739 WP_000739360.1.56765 WP_000739360.1.56902 WP_000739360.1.57009 WP_000739360.1.57194 WP_000739360.1.57252 WP_000739360.1.57503 WP_000739360.1.57620 WP_000739360.1.57677 WP_000739360.1.57787 WP_000739360.1.57917 WP_000739360.1.5793 WP_000739360.1.58021 WP_000739360.1.58032 WP_000739360.1.58124 WP_000739360.1.58135 WP_000739360.1.58171 WP_000739360.1.58189 WP_000739360.1.58197 WP_000739360.1.58217 WP_000739360.1.58225 WP_000739360.1.58268 WP_000739360.1.58434 WP_000739360.1.58474 WP_000739360.1.58483 WP_000739360.1.58492 WP_000739360.1.58522 WP_000739360.1.58574 WP_000739360.1.58642 WP_000739360.1.58738 WP_000739360.1.59066 WP_000739360.1.59308 WP_000739360.1.59356 WP_000739360.1.59367 WP_000739360.1.59589 WP_000739360.1.59906 WP_000739360.1.60180 WP_000739360.1.60532 WP_000739360.1.60541 WP_000739360.1.60574 WP_000739360.1.60601 WP_000739360.1.60615 WP_000739360.1.60693 WP_000739360.1.60812 WP_000739360.1.6092 WP_000739360.1.61028 WP_000739360.1.61151 WP_000739360.1.61220 WP_000739360.1.61300 WP_000739360.1.61307 WP_000739360.1.61396 WP_000739360.1.6140 WP_000739360.1.61404 WP_000739360.1.61495 WP_000739360.1.61506 WP_000739360.1.61560 WP_000739360.1.61568 WP_000739360.1.61632 WP_000739360.1.61733 WP_000739360.1.61735 WP_000739360.1.61751 WP_000739360.1.61882 WP_000739360.1.61959 WP_000739360.1.61992 WP_000739360.1.62006 WP_000739360.1.62022 WP_000739360.1.62129 WP_000739360.1.62134 WP_000739360.1.62174 WP_000739360.1.62197 WP_000739360.1.62235 WP_000739360.1.6226 WP_000739360.1.62421 WP_000739360.1.62434 WP_000739360.1.62465 WP_000739360.1.62521 WP_000739360.1.62528 WP_000739360.1.62600 WP_000739360.1.62613 WP_000739360.1.62793 WP_000739360.1.62803 WP_000739360.1.62814 WP_000739360.1.62867 WP_000739360.1.6288 WP_000739360.1.62944 WP_000739360.1.62994 WP_000739360.1.63033 WP_000739360.1.63055 WP_000739360.1.6306 WP_000739360.1.63075 WP_000739360.1.63077 WP_000739360.1.6309 WP_000739360.1.63093 WP_000739360.1.63191 WP_000739360.1.6324 WP_000739360.1.63245 WP_000739360.1.63442 WP_000739360.1.63543 WP_000739360.1.63741 WP_000739360.1.63756 WP_000739360.1.63891 WP_000739360.1.63938 WP_000739360.1.63971 WP_000739360.1.64042 WP_000739360.1.64135 WP_000739360.1.64225 WP_000739360.1.64245 WP_000739360.1.64255 WP_000739360.1.64338 WP_000739360.1.64359 WP_000739360.1.64373 WP_000739360.1.64399 WP_000739360.1.64464 WP_000739360.1.6447 WP_000739360.1.64496 WP_000739360.1.64653 WP_000739360.1.6467 WP_000739360.1.64679 WP_000739360.1.64723 WP_000739360.1.64725 WP_000739360.1.6478 WP_000739360.1.64837 WP_000739360.1.64882 WP_000739360.1.64890 WP_000739360.1.64913 WP_000739360.1.64931 WP_000739360.1.64960 WP_000739360.1.65126 WP_000739360.1.65235 WP_000739360.1.65268 WP_000739360.1.6532 WP_000739360.1.65362 WP_000739360.1.65368 WP_000739360.1.65396 WP_000739360.1.65431 WP_000739360.1.65442 WP_000739360.1.65476 WP_000739360.1.65485 WP_000739360.1.65537 WP_000739360.1.65577 WP_000739360.1.65690 WP_000739360.1.65722 WP_000739360.1.6577 WP_000739360.1.65837 WP_000739360.1.65960 WP_000739360.1.66024 WP_000739360.1.66139 WP_000739360.1.66170 WP_000739360.1.66191 WP_000739360.1.663 WP_000739360.1.66381 WP_000739360.1.66517 WP_000739360.1.66586 WP_000739360.1.66640 WP_000739360.1.66914 WP_000739360.1.66917 WP_000739360.1.66983 WP_000739360.1.67039 WP_000739360.1.67076 WP_000739360.1.67096 WP_000739360.1.67169 WP_000739360.1.67215 WP_000739360.1.67302 WP_000739360.1.67358 WP_000739360.1.67458 WP_000739360.1.67510 WP_000739360.1.67515 WP_000739360.1.6773 WP_000739360.1.67761 WP_000739360.1.67881 WP_000739360.1.67950 WP_000739360.1.6821 WP_000739360.1.68220 WP_000739360.1.68306 WP_000739360.1.68310 WP_000739360.1.68578 WP_000739360.1.68622 WP_000739360.1.68644 WP_000739360.1.68660 WP_000739360.1.68784 WP_000739360.1.68814 WP_000739360.1.68820 WP_000739360.1.68851 WP_000739360.1.6894 WP_000739360.1.690 WP_000739360.1.69005 WP_000739360.1.69017 WP_000739360.1.69211 WP_000739360.1.69246 WP_000739360.1.69321 WP_000739360.1.69420 WP_000739360.1.69531 WP_000739360.1.69591 WP_000739360.1.69608 WP_000739360.1.69623 WP_000739360.1.69641 WP_000739360.1.69687 WP_000739360.1.69695 WP_000739360.1.69752 WP_000739360.1.69797 WP_000739360.1.69863 WP_000739360.1.69954 WP_000739360.1.69962 WP_000739360.1.70192 WP_000739360.1.70199 WP_000739360.1.70316 WP_000739360.1.70329 WP_000739360.1.70453 WP_000739360.1.70486 WP_000739360.1.70490 WP_000739360.1.70508 WP_000739360.1.70520 WP_000739360.1.70538 WP_000739360.1.70567 WP_000739360.1.7057 WP_000739360.1.7059 WP_000739360.1.70949 WP_000739360.1.70987 WP_000739360.1.71017 WP_000739360.1.71020 WP_000739360.1.71206 WP_000739360.1.71270 WP_000739360.1.71360 WP_000739360.1.71534 WP_000739360.1.71571 WP_000739360.1.71599 WP_000739360.1.71605 WP_000739360.1.71685 WP_000739360.1.71697 WP_000739360.1.71818 WP_000739360.1.71879 WP_000739360.1.71926 WP_000739360.1.72071 WP_000739360.1.72082 WP_000739360.1.72088 WP_000739360.1.72135 WP_000739360.1.72160 WP_000739360.1.72235 WP_000739360.1.72309 WP_000739360.1.72407 WP_000739360.1.72472 WP_000739360.1.72565 WP_000739360.1.7262 WP_000739360.1.72628 WP_000739360.1.72854 WP_000739360.1.72934 WP_000739360.1.72940 WP_000739360.1.7299 WP_000739360.1.73043 WP_000739360.1.73065 WP_000739360.1.73089 WP_000739360.1.73106 WP_000739360.1.732 WP_000739360.1.73214 WP_000739360.1.73226 WP_000739360.1.73324 WP_000739360.1.7347 WP_000739360.1.73502 WP_000739360.1.73548 WP_000739360.1.73568 WP_000739360.1.73588 WP_000739360.1.73796 WP_000739360.1.73939 WP_000739360.1.74033 WP_000739360.1.74128 WP_000739360.1.74231 WP_000739360.1.74233 WP_000739360.1.74314 WP_000739360.1.74363 WP_000739360.1.74396 WP_000739360.1.74443 WP_000739360.1.74448 WP_000739360.1.74537 WP_000739360.1.74548 WP_000739360.1.74608 WP_000739360.1.74848 WP_000739360.1.7488 WP_000739360.1.7497 WP_000739360.1.75096 WP_000739360.1.75102 WP_000739360.1.75156 WP_000739360.1.75284 WP_000739360.1.75370 WP_000739360.1.75445 WP_000739360.1.7548 WP_000739360.1.75490 WP_000739360.1.75558 WP_000739360.1.7573 WP_000739360.1.75877 WP_000739360.1.75880 WP_000739360.1.75899 WP_000739360.1.76080 WP_000739360.1.76202 WP_000739360.1.76220 WP_000739360.1.76264 WP_000739360.1.76393 WP_000739360.1.76458 WP_000739360.1.76591 WP_000739360.1.7678 WP_000739360.1.76826 WP_000739360.1.76830 WP_000739360.1.76942 WP_000739360.1.76980 WP_000739360.1.77172 WP_000739360.1.77223 WP_000739360.1.77379 WP_000739360.1.77663 WP_000739360.1.77670 WP_000739360.1.77785 WP_000739360.1.77847 WP_000739360.1.77877 WP_000739360.1.77976 WP_000739360.1.78045 WP_000739360.1.78078 WP_000739360.1.78129 WP_000739360.1.78139 WP_000739360.1.7822 WP_000739360.1.78241 WP_000739360.1.78379 WP_000739360.1.7846 WP_000739360.1.78467 WP_000739360.1.78535 WP_000739360.1.78609 WP_000739360.1.7876 WP_000739360.1.78832 WP_000739360.1.78866 WP_000739360.1.78887 WP_000739360.1.78889 WP_000739360.1.78965 WP_000739360.1.78979 WP_000739360.1.79079 WP_000739360.1.79096 WP_000739360.1.7915 WP_000739360.1.79245 WP_000739360.1.79338 WP_000739360.1.79496 WP_000739360.1.79612 WP_000739360.1.79637 WP_000739360.1.79671 WP_000739360.1.79675 WP_000739360.1.79705 WP_000739360.1.8003 WP_000739360.1.80130 WP_000739360.1.8015 WP_000739360.1.80186 WP_000739360.1.80191 WP_000739360.1.80228 WP_000739360.1.80251 WP_000739360.1.80268 WP_000739360.1.80279 WP_000739360.1.80294 WP_000739360.1.80321 WP_000739360.1.80349 WP_000739360.1.80372 WP_000739360.1.80373 WP_000739360.1.80539 WP_000739360.1.80691 WP_000739360.1.80774 WP_000739360.1.80949 WP_000739360.1.81292 WP_000739360.1.81398 WP_000739360.1.81663 WP_000739360.1.81677 WP_000739360.1.81716 WP_000739360.1.81745 WP_000739360.1.81769 WP_000739360.1.81890 WP_000739360.1.81894 WP_000739360.1.81959 WP_000739360.1.82042 WP_000739360.1.82159 WP_000739360.1.82297 WP_000739360.1.82306 WP_000739360.1.82342 WP_000739360.1.82382 WP_000739360.1.82407 WP_000739360.1.82481 WP_000739360.1.82528 WP_000739360.1.82537 WP_000739360.1.82650 WP_000739360.1.82680 WP_000739360.1.8293 WP_000739360.1.82969 WP_000739360.1.82994 WP_000739360.1.83055 WP_000739360.1.83189 WP_000739360.1.83414 WP_000739360.1.8352 WP_000739360.1.83726 WP_000739360.1.83922 WP_000739360.1.83934 WP_000739360.1.83963 WP_000739360.1.83964 WP_000739360.1.83974 WP_000739360.1.83978 WP_000739360.1.84038 WP_000739360.1.84052 WP_000739360.1.84175 WP_000739360.1.84213 WP_000739360.1.84214 WP_000739360.1.84225 WP_000739360.1.84292 WP_000739360.1.84304 WP_000739360.1.84505 WP_000739360.1.84640 WP_000739360.1.8481 WP_000739360.1.84897 WP_000739360.1.84998 WP_000739360.1.85195 WP_000739360.1.85373 WP_000739360.1.85392 WP_000739360.1.85434 WP_000739360.1.85496 WP_000739360.1.85548 WP_000739360.1.85552 WP_000739360.1.85581 WP_000739360.1.85652 WP_000739360.1.85659 WP_000739360.1.85697 WP_000739360.1.86061 WP_000739360.1.86112 WP_000739360.1.86118 WP_000739360.1.8612 WP_000739360.1.86238 WP_000739360.1.86313 WP_000739360.1.86456 WP_000739360.1.8655 WP_000739360.1.86558 WP_000739360.1.86689 WP_000739360.1.86723 WP_000739360.1.8674 WP_000739360.1.86742 WP_000739360.1.86747 WP_000739360.1.86918 WP_000739360.1.86996 WP_000739360.1.87065 WP_000739360.1.87421 WP_000739360.1.87731 WP_000739360.1.87792 WP_000739360.1.87815 WP_000739360.1.87839 WP_000739360.1.87863 WP_000739360.1.87904 WP_000739360.1.8799 WP_000739360.1.88103 WP_000739360.1.88129 WP_000739360.1.88167 WP_000739360.1.8818 WP_000739360.1.88206 WP_000739360.1.88228 WP_000739360.1.88232 WP_000739360.1.88365 WP_000739360.1.88488 WP_000739360.1.88523 WP_000739360.1.88940 WP_000739360.1.89029 WP_000739360.1.89190 WP_000739360.1.89254 WP_000739360.1.89294 WP_000739360.1.89370 WP_000739360.1.89563 WP_000739360.1.89620 WP_000739360.1.89645 WP_000739360.1.89891 WP_000739360.1.89913 WP_000739360.1.90053 WP_000739360.1.90059 WP_000739360.1.90304 WP_000739360.1.90319 WP_000739360.1.90396 WP_000739360.1.90482 WP_000739360.1.90501 WP_000739360.1.90502 WP_000739360.1.90577 WP_000739360.1.90603 WP_000739360.1.90615 WP_000739360.1.90678 WP_000739360.1.90768 WP_000739360.1.90869 WP_000739360.1.90897 WP_000739360.1.90900 WP_000739360.1.90925 WP_000739360.1.90957 WP_000739360.1.91024 WP_000739360.1.91058 WP_000739360.1.91078 WP_000739360.1.91099 WP_000739360.1.91193 WP_000739360.1.91269 WP_000739360.1.91358 WP_000739360.1.91413 WP_000739360.1.91481 WP_000739360.1.91545 WP_000739360.1.91718 WP_000739360.1.91902 WP_000739360.1.91927 WP_000739360.1.92010 WP_000739360.1.92124 WP_000739360.1.92271 WP_000739360.1.92342 WP_000739360.1.92386 WP_000739360.1.92640 WP_000739360.1.92866 WP_000739360.1.92874 WP_000739360.1.92878 WP_000739360.1.9297 WP_000739360.1.9299 WP_000739360.1.93178 WP_000739360.1.93253 WP_000739360.1.93279 WP_000739360.1.93285 WP_000739360.1.9332 WP_000739360.1.93475 WP_000739360.1.93515 WP_000739360.1.93522 WP_000739360.1.93550 WP_000739360.1.93595 WP_000739360.1.93616 WP_000739360.1.93641 WP_000739360.1.93703 WP_000739360.1.93869 WP_000739360.1.93878 WP_000739360.1.93902 WP_000739360.1.93974 WP_000739360.1.94024 WP_000739360.1.9403 WP_000739360.1.94092 WP_000739360.1.94101 WP_000739360.1.94104 WP_000739360.1.94157 WP_000739360.1.94170 WP_000739360.1.94247 WP_000739360.1.94263 WP_000739360.1.9429 WP_000739360.1.94316 WP_000739360.1.94330 WP_000739360.1.94391 WP_000739360.1.94503 WP_000739360.1.94711 WP_000739360.1.94883 WP_000739360.1.95058 WP_000739360.1.95069 WP_000739360.1.95073 WP_000739360.1.95104 WP_000739360.1.9518 WP_000739360.1.95219 WP_000739360.1.95322 WP_000739360.1.95468 WP_000739360.1.95553 WP_000739360.1.95602 WP_000739360.1.95707 WP_000739360.1.95762 WP_000739360.1.95868 WP_000739360.1.95870 WP_000739360.1.95936 WP_000739360.1.95998 WP_000739360.1.96003 WP_000739360.1.96007 WP_000739360.1.96024 WP_000739360.1.96049 WP_000739360.1.96103 WP_000739360.1.9621 WP_000739360.1.96309 WP_000739360.1.9632 WP_000739360.1.96436 WP_000739360.1.96464 WP_000739360.1.96487 WP_000739360.1.96629 WP_000739360.1.96652 WP_000739360.1.96728 WP_000739360.1.96812 WP_000739360.1.96833 WP_000739360.1.96858 WP_000739360.1.96913 WP_000739360.1.97035 WP_000739360.1.97158 WP_000739360.1.97254 WP_000739360.1.97442 WP_000739360.1.97485 WP_000739360.1.97582 WP_000739360.1.9760 WP_000739360.1.97738 WP_000739360.1.97804 WP_000739360.1.97831 WP_000739360.1.97866 WP_000739360.1.97891 WP_000739360.1.97925 WP_000739360.1.97994 WP_000739360.1.97998 WP_000739360.1.9806 WP_000739360.1.98376 WP_000739360.1.98399 WP_000739360.1.98504 WP_000739360.1.98648 WP_000739360.1.98759 WP_000739360.1.98771 WP_000739360.1.98787 WP_000739360.1.98905 WP_000739360.1.98990 WP_000739360.1.99114 WP_000739360.1.99148 WP_000739360.1.99203 WP_000739360.1.99225 WP_000739360.1.99309 WP_000739360.1.99314 WP_000739360.1.99362 WP_000739360.1.99371 WP_000739360.1.99382 WP_000739360.1.99478 WP_000739360.1.99502 WP_000739360.1.99565 WP_000739360.1.99593 WP_000739360.1.99628 WP_000739360.1.99685 WP_000739360.1.99753 gi|194398115|ref|YP_002037927.1| gi|169833629|ref|YP_001694773.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]