SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 171101.spr0516 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  171101.spr0516
Domain Number 1 Region: 45-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.19e-46
Family Ribonuclease PH domain 1-like 0.0000328
Further Details:      
 
Domain Number 2 Region: 335-528
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.24e-43
Family Ribonuclease PH domain 1-like 0.00000786
Further Details:      
 
Domain Number 3 Region: 491-589
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.28e-29
Family Ribonuclease PH domain 2-like 0.0000925
Further Details:      
 
Domain Number 4 Region: 181-271
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.67e-28
Family Ribonuclease PH domain 2-like 0.0017
Further Details:      
 
Domain Number 5 Region: 597-681
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.45e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 6 Region: 654-735
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.29e-21
Family Cold shock DNA-binding domain-like 0.0012
Further Details:      
 
Domain Number 7 Region: 274-361
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000000654
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 171101.spr0516
Sequence length 775
Comment (Streptococcus pneumoniae R6)
Sequence
MSSSKTSSVSYFYFAFDVLGILIFVGKAYNFINPKGIKMAKQVFQTTFAGRELIVETGQV
AKQANGSVVVRYGESTVLTAAVMSKKMATGDFFPLQVNYEEKMYAAGKFPGGFMKREGRP
STDATLTARLIDRPIRPMFAEGFRNEVQVINTVLSYDENASAPMAAMFGSSLALSISDIP
FDGPIAGVQVGYVDGQIIINPSQEQAEQSLLELTVAGTKHAINMVESGAKELSEEIMLEA
LLKGHEAVKELIAFQEEIVAAVGKEKAEVELLHVDAELQAEIIAAYNSDLQKAVQVEEKL
AREAATQAVKDQVTAVYEEKYANHEEFDRIMRDVAEILEQMEHAEVRRLITEDKVRPDGR
KVDEIRPLDAVVDFLPRVHGSGLFTRGQTQALSVLTLAPMGETQIIDGLDPEYKKRFMHH
YNFPQYSVGETGRYGAPGRREIGHGALGERALAQVLPSLEEFPYAIRLVAEVLESNGSSS
QASICAGTLALMAGGVPIKAPVAGIAMGLISDGNNYTVLTDIQGLEDHFGDMDFKVAGTR
DGITALQMDIKIQGITAEILTEALAQAKKARFEILDVIEATIPEVRPELAPTAPKIDTIK
IDVDKIKIVIGKGGETIDKIIAETGVKIDIDEEGNVSIYSSDQDAINRAKEIIAGLVREA
KVDEVYRAKVVRIEKFGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKI
DEKGRIDASMKALLPRPPKPEHDEKGEKSERPHRPRHQKDYKPKKEFTETPKDSE
Download sequence
Identical sequences gi|15902560|ref|NP_358110.1| NP_358110.1.60829 gi|116515732|ref|YP_816014.1| 171101.spr0516 373153.SPD_0512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]