SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 171101.spr1568 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  171101.spr1568
Domain Number 1 Region: 27-341
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 5.65e-83
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000313
Further Details:      
 
Domain Number 2 Region: 340-479
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-26
Family Glycosyl hydrolases family 32 C-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 171101.spr1568
Sequence length 484
Comment (Streptococcus pneumoniae R6)
Sequence
MEWTTERRYRLYQDWTQEEIQHIKENMAQSPWHTHYHVEPKTGLLNDPNGFSYFDGKWIL
FYQNFPFGAAHGLKSWAQLESDDLVHFKETGIKVLPDTPLDSHGAYSGSAMQFGDNLFLF
YTGNVRDENWIRHPYQIGALMDKEGKITKIDKILIDQPADSTDHFRDPQIFNFKGQYYAV
VGGQDLEKKGFVRLYKAVNNDYTNWQAVGDLDFANDRTAYMMECPNLVFVEEHPVLLYCP
QGLDKKVLDYDNIFPNMYKIGASFDPKNAKMVDVSQLQNMDYGFEAYATQAFNAPDGRAL
AVSWLGLPDVSYPSDRFDHQGTFSLVKELTIKDDKLYQYPVAAIKDLRASEEAFSNRSQT
KNTYELELNLEANSQSEIVLLADKEGKGLSINFDLVNGQVTVDRSQAGEQYAQEFGTTRS
CPIENQATTATIFIDNSVFEIFINKGEKVFSGRVFPHADQNGILIKSGNPTGTYYELDYG
RKTN
Download sequence
Identical sequences A0A0H2ZPQ2 A0A213IHJ1 G6LPH5 Q8DNS7
gi|116516412|ref|YP_816988.1| gi|15903610|ref|NP_359160.1| NP_359160.1.60829 WP_000455299.1.100048 WP_000455299.1.100186 WP_000455299.1.100364 WP_000455299.1.100829 WP_000455299.1.100997 WP_000455299.1.101044 WP_000455299.1.101098 WP_000455299.1.101201 WP_000455299.1.101274 WP_000455299.1.101286 WP_000455299.1.101287 WP_000455299.1.101315 WP_000455299.1.101373 WP_000455299.1.101484 WP_000455299.1.101560 WP_000455299.1.101765 WP_000455299.1.102141 WP_000455299.1.10314 WP_000455299.1.10426 WP_000455299.1.10500 WP_000455299.1.10515 WP_000455299.1.1070 WP_000455299.1.10819 WP_000455299.1.10910 WP_000455299.1.10952 WP_000455299.1.11 WP_000455299.1.11045 WP_000455299.1.11151 WP_000455299.1.11154 WP_000455299.1.11205 WP_000455299.1.11425 WP_000455299.1.11792 WP_000455299.1.11902 WP_000455299.1.12034 WP_000455299.1.12046 WP_000455299.1.12068 WP_000455299.1.12131 WP_000455299.1.12407 WP_000455299.1.12427 WP_000455299.1.12444 WP_000455299.1.12470 WP_000455299.1.12487 WP_000455299.1.12673 WP_000455299.1.12805 WP_000455299.1.12905 WP_000455299.1.12952 WP_000455299.1.13048 WP_000455299.1.13209 WP_000455299.1.139 WP_000455299.1.1391 WP_000455299.1.13997 WP_000455299.1.14260 WP_000455299.1.14335 WP_000455299.1.14384 WP_000455299.1.14541 WP_000455299.1.14722 WP_000455299.1.15266 WP_000455299.1.15425 WP_000455299.1.15720 WP_000455299.1.15841 WP_000455299.1.16094 WP_000455299.1.16184 WP_000455299.1.16287 WP_000455299.1.16676 WP_000455299.1.1672 WP_000455299.1.16727 WP_000455299.1.16889 WP_000455299.1.17144 WP_000455299.1.17252 WP_000455299.1.17330 WP_000455299.1.17716 WP_000455299.1.17776 WP_000455299.1.17810 WP_000455299.1.17844 WP_000455299.1.17971 WP_000455299.1.18130 WP_000455299.1.18266 WP_000455299.1.18279 WP_000455299.1.18415 WP_000455299.1.18534 WP_000455299.1.18644 WP_000455299.1.18771 WP_000455299.1.18869 WP_000455299.1.18903 WP_000455299.1.18951 WP_000455299.1.19201 WP_000455299.1.19236 WP_000455299.1.19385 WP_000455299.1.19470 WP_000455299.1.19513 WP_000455299.1.19631 WP_000455299.1.19730 WP_000455299.1.1983 WP_000455299.1.20149 WP_000455299.1.2030 WP_000455299.1.20421 WP_000455299.1.20516 WP_000455299.1.20603 WP_000455299.1.20637 WP_000455299.1.20915 WP_000455299.1.21175 WP_000455299.1.21216 WP_000455299.1.21278 WP_000455299.1.21421 WP_000455299.1.21599 WP_000455299.1.2167 WP_000455299.1.22014 WP_000455299.1.22057 WP_000455299.1.22119 WP_000455299.1.22263 WP_000455299.1.22480 WP_000455299.1.22556 WP_000455299.1.23111 WP_000455299.1.23178 WP_000455299.1.23334 WP_000455299.1.23481 WP_000455299.1.23620 WP_000455299.1.23635 WP_000455299.1.23930 WP_000455299.1.23991 WP_000455299.1.24094 WP_000455299.1.2429 WP_000455299.1.243 WP_000455299.1.24481 WP_000455299.1.24497 WP_000455299.1.2465 WP_000455299.1.24772 WP_000455299.1.24825 WP_000455299.1.249 WP_000455299.1.24947 WP_000455299.1.25005 WP_000455299.1.25106 WP_000455299.1.252 WP_000455299.1.25293 WP_000455299.1.2556 WP_000455299.1.25685 WP_000455299.1.25696 WP_000455299.1.25767 WP_000455299.1.25883 WP_000455299.1.25958 WP_000455299.1.26078 WP_000455299.1.26279 WP_000455299.1.26389 WP_000455299.1.26392 WP_000455299.1.26413 WP_000455299.1.26490 WP_000455299.1.26497 WP_000455299.1.26910 WP_000455299.1.2703 WP_000455299.1.27219 WP_000455299.1.27252 WP_000455299.1.2729 WP_000455299.1.27394 WP_000455299.1.27432 WP_000455299.1.2750 WP_000455299.1.27636 WP_000455299.1.27866 WP_000455299.1.27907 WP_000455299.1.28014 WP_000455299.1.28028 WP_000455299.1.28248 WP_000455299.1.28549 WP_000455299.1.28680 WP_000455299.1.28846 WP_000455299.1.28869 WP_000455299.1.28945 WP_000455299.1.28956 WP_000455299.1.28997 WP_000455299.1.29009 WP_000455299.1.29151 WP_000455299.1.2922 WP_000455299.1.29300 WP_000455299.1.29323 WP_000455299.1.2940 WP_000455299.1.2970 WP_000455299.1.29852 WP_000455299.1.29868 WP_000455299.1.30011 WP_000455299.1.30233 WP_000455299.1.30368 WP_000455299.1.30406 WP_000455299.1.30612 WP_000455299.1.31427 WP_000455299.1.3152 WP_000455299.1.31553 WP_000455299.1.31603 WP_000455299.1.31619 WP_000455299.1.31695 WP_000455299.1.31945 WP_000455299.1.31974 WP_000455299.1.32032 WP_000455299.1.32083 WP_000455299.1.32084 WP_000455299.1.32280 WP_000455299.1.32282 WP_000455299.1.32362 WP_000455299.1.3241 WP_000455299.1.32604 WP_000455299.1.32642 WP_000455299.1.33013 WP_000455299.1.33021 WP_000455299.1.33070 WP_000455299.1.33072 WP_000455299.1.33182 WP_000455299.1.33188 WP_000455299.1.33286 WP_000455299.1.33354 WP_000455299.1.33361 WP_000455299.1.33415 WP_000455299.1.33528 WP_000455299.1.3359 WP_000455299.1.33709 WP_000455299.1.33749 WP_000455299.1.33815 WP_000455299.1.34015 WP_000455299.1.34041 WP_000455299.1.3427 WP_000455299.1.34297 WP_000455299.1.34327 WP_000455299.1.34506 WP_000455299.1.34616 WP_000455299.1.34719 WP_000455299.1.34744 WP_000455299.1.34746 WP_000455299.1.34776 WP_000455299.1.3486 WP_000455299.1.34886 WP_000455299.1.3496 WP_000455299.1.35217 WP_000455299.1.35239 WP_000455299.1.35392 WP_000455299.1.35411 WP_000455299.1.35665 WP_000455299.1.35875 WP_000455299.1.3589 WP_000455299.1.35920 WP_000455299.1.35932 WP_000455299.1.35972 WP_000455299.1.3608 WP_000455299.1.3609 WP_000455299.1.36139 WP_000455299.1.3618 WP_000455299.1.36330 WP_000455299.1.36476 WP_000455299.1.36554 WP_000455299.1.36591 WP_000455299.1.36715 WP_000455299.1.36731 WP_000455299.1.36772 WP_000455299.1.36795 WP_000455299.1.36961 WP_000455299.1.36963 WP_000455299.1.37170 WP_000455299.1.37205 WP_000455299.1.37227 WP_000455299.1.37243 WP_000455299.1.37289 WP_000455299.1.37357 WP_000455299.1.3763 WP_000455299.1.37658 WP_000455299.1.37840 WP_000455299.1.37883 WP_000455299.1.38355 WP_000455299.1.38527 WP_000455299.1.38624 WP_000455299.1.38708 WP_000455299.1.38712 WP_000455299.1.38887 WP_000455299.1.39087 WP_000455299.1.39125 WP_000455299.1.39133 WP_000455299.1.39339 WP_000455299.1.3939 WP_000455299.1.39793 WP_000455299.1.39824 WP_000455299.1.39828 WP_000455299.1.39931 WP_000455299.1.40041 WP_000455299.1.40216 WP_000455299.1.40327 WP_000455299.1.40434 WP_000455299.1.40726 WP_000455299.1.40801 WP_000455299.1.41025 WP_000455299.1.41126 WP_000455299.1.41360 WP_000455299.1.41475 WP_000455299.1.41476 WP_000455299.1.41586 WP_000455299.1.41850 WP_000455299.1.4201 WP_000455299.1.42034 WP_000455299.1.42229 WP_000455299.1.42232 WP_000455299.1.4230 WP_000455299.1.42315 WP_000455299.1.4249 WP_000455299.1.42546 WP_000455299.1.42933 WP_000455299.1.43051 WP_000455299.1.43219 WP_000455299.1.43408 WP_000455299.1.43496 WP_000455299.1.43539 WP_000455299.1.43558 WP_000455299.1.43644 WP_000455299.1.43701 WP_000455299.1.44042 WP_000455299.1.44387 WP_000455299.1.44512 WP_000455299.1.44764 WP_000455299.1.44844 WP_000455299.1.44850 WP_000455299.1.44858 WP_000455299.1.44937 WP_000455299.1.45051 WP_000455299.1.4547 WP_000455299.1.45531 WP_000455299.1.45539 WP_000455299.1.4554 WP_000455299.1.45687 WP_000455299.1.45688 WP_000455299.1.45825 WP_000455299.1.45948 WP_000455299.1.45952 WP_000455299.1.46094 WP_000455299.1.46156 WP_000455299.1.46206 WP_000455299.1.46296 WP_000455299.1.46607 WP_000455299.1.46649 WP_000455299.1.46694 WP_000455299.1.46809 WP_000455299.1.469 WP_000455299.1.47099 WP_000455299.1.47351 WP_000455299.1.47409 WP_000455299.1.47415 WP_000455299.1.47526 WP_000455299.1.47651 WP_000455299.1.47781 WP_000455299.1.47819 WP_000455299.1.48060 WP_000455299.1.48395 WP_000455299.1.48613 WP_000455299.1.48627 WP_000455299.1.48718 WP_000455299.1.48799 WP_000455299.1.48944 WP_000455299.1.490 WP_000455299.1.49050 WP_000455299.1.49178 WP_000455299.1.49208 WP_000455299.1.49408 WP_000455299.1.49874 WP_000455299.1.49889 WP_000455299.1.49964 WP_000455299.1.50083 WP_000455299.1.50094 WP_000455299.1.50151 WP_000455299.1.50234 WP_000455299.1.50263 WP_000455299.1.50532 WP_000455299.1.50615 WP_000455299.1.50739 WP_000455299.1.50797 WP_000455299.1.50921 WP_000455299.1.51012 WP_000455299.1.51054 WP_000455299.1.51089 WP_000455299.1.5116 WP_000455299.1.51361 WP_000455299.1.51420 WP_000455299.1.51449 WP_000455299.1.51467 WP_000455299.1.51806 WP_000455299.1.5204 WP_000455299.1.52042 WP_000455299.1.52116 WP_000455299.1.52335 WP_000455299.1.52443 WP_000455299.1.52666 WP_000455299.1.52681 WP_000455299.1.52726 WP_000455299.1.52843 WP_000455299.1.52923 WP_000455299.1.52953 WP_000455299.1.52978 WP_000455299.1.52988 WP_000455299.1.53183 WP_000455299.1.53205 WP_000455299.1.53357 WP_000455299.1.53384 WP_000455299.1.53449 WP_000455299.1.53524 WP_000455299.1.53660 WP_000455299.1.53773 WP_000455299.1.53785 WP_000455299.1.53789 WP_000455299.1.54001 WP_000455299.1.54020 WP_000455299.1.54110 WP_000455299.1.54163 WP_000455299.1.5418 WP_000455299.1.543 WP_000455299.1.54372 WP_000455299.1.54401 WP_000455299.1.54402 WP_000455299.1.5453 WP_000455299.1.54582 WP_000455299.1.54796 WP_000455299.1.54805 WP_000455299.1.550 WP_000455299.1.55299 WP_000455299.1.55685 WP_000455299.1.55733 WP_000455299.1.560 WP_000455299.1.56041 WP_000455299.1.56054 WP_000455299.1.56136 WP_000455299.1.56266 WP_000455299.1.56518 WP_000455299.1.5663 WP_000455299.1.56958 WP_000455299.1.57017 WP_000455299.1.57103 WP_000455299.1.57127 WP_000455299.1.57194 WP_000455299.1.57219 WP_000455299.1.57442 WP_000455299.1.57530 WP_000455299.1.57725 WP_000455299.1.57726 WP_000455299.1.57816 WP_000455299.1.57822 WP_000455299.1.57867 WP_000455299.1.58225 WP_000455299.1.58376 WP_000455299.1.58522 WP_000455299.1.58574 WP_000455299.1.58595 WP_000455299.1.59065 WP_000455299.1.59081 WP_000455299.1.59109 WP_000455299.1.59141 WP_000455299.1.5916 WP_000455299.1.59235 WP_000455299.1.5941 WP_000455299.1.59424 WP_000455299.1.59534 WP_000455299.1.59552 WP_000455299.1.59558 WP_000455299.1.59895 WP_000455299.1.59903 WP_000455299.1.60014 WP_000455299.1.60256 WP_000455299.1.60385 WP_000455299.1.60521 WP_000455299.1.60596 WP_000455299.1.60911 WP_000455299.1.60977 WP_000455299.1.61159 WP_000455299.1.61217 WP_000455299.1.61254 WP_000455299.1.61302 WP_000455299.1.61365 WP_000455299.1.61378 WP_000455299.1.61423 WP_000455299.1.61514 WP_000455299.1.61546 WP_000455299.1.61611 WP_000455299.1.61632 WP_000455299.1.61735 WP_000455299.1.6177 WP_000455299.1.61839 WP_000455299.1.61882 WP_000455299.1.61912 WP_000455299.1.6192 WP_000455299.1.62022 WP_000455299.1.6207 WP_000455299.1.62137 WP_000455299.1.62283 WP_000455299.1.62287 WP_000455299.1.62394 WP_000455299.1.62585 WP_000455299.1.62600 WP_000455299.1.62836 WP_000455299.1.62921 WP_000455299.1.62994 WP_000455299.1.6306 WP_000455299.1.63375 WP_000455299.1.63753 WP_000455299.1.63846 WP_000455299.1.63931 WP_000455299.1.63936 WP_000455299.1.63938 WP_000455299.1.63988 WP_000455299.1.64132 WP_000455299.1.64313 WP_000455299.1.64572 WP_000455299.1.6467 WP_000455299.1.64679 WP_000455299.1.64728 WP_000455299.1.64739 WP_000455299.1.64750 WP_000455299.1.64876 WP_000455299.1.64931 WP_000455299.1.6504 WP_000455299.1.65091 WP_000455299.1.65119 WP_000455299.1.6515 WP_000455299.1.65485 WP_000455299.1.65587 WP_000455299.1.66045 WP_000455299.1.66115 WP_000455299.1.66230 WP_000455299.1.663 WP_000455299.1.66586 WP_000455299.1.66620 WP_000455299.1.66687 WP_000455299.1.66894 WP_000455299.1.669 WP_000455299.1.67169 WP_000455299.1.67215 WP_000455299.1.67274 WP_000455299.1.67304 WP_000455299.1.67327 WP_000455299.1.67353 WP_000455299.1.67443 WP_000455299.1.67469 WP_000455299.1.67684 WP_000455299.1.67807 WP_000455299.1.67965 WP_000455299.1.67967 WP_000455299.1.68192 WP_000455299.1.68220 WP_000455299.1.68267 WP_000455299.1.68430 WP_000455299.1.68535 WP_000455299.1.68567 WP_000455299.1.68605 WP_000455299.1.68653 WP_000455299.1.68822 WP_000455299.1.69148 WP_000455299.1.69230 WP_000455299.1.69246 WP_000455299.1.69731 WP_000455299.1.69757 WP_000455299.1.7 WP_000455299.1.70150 WP_000455299.1.70166 WP_000455299.1.70308 WP_000455299.1.70315 WP_000455299.1.7059 WP_000455299.1.70916 WP_000455299.1.70987 WP_000455299.1.71053 WP_000455299.1.71551 WP_000455299.1.71673 WP_000455299.1.71758 WP_000455299.1.72096 WP_000455299.1.72163 WP_000455299.1.72192 WP_000455299.1.72233 WP_000455299.1.72534 WP_000455299.1.72932 WP_000455299.1.72940 WP_000455299.1.73106 WP_000455299.1.73181 WP_000455299.1.73320 WP_000455299.1.73324 WP_000455299.1.73357 WP_000455299.1.73369 WP_000455299.1.73522 WP_000455299.1.74127 WP_000455299.1.7431 WP_000455299.1.74548 WP_000455299.1.7466 WP_000455299.1.74751 WP_000455299.1.75053 WP_000455299.1.75074 WP_000455299.1.7517 WP_000455299.1.75259 WP_000455299.1.75429 WP_000455299.1.75455 WP_000455299.1.75547 WP_000455299.1.75582 WP_000455299.1.75654 WP_000455299.1.75729 WP_000455299.1.75880 WP_000455299.1.76041 WP_000455299.1.76080 WP_000455299.1.76161 WP_000455299.1.76375 WP_000455299.1.76453 WP_000455299.1.76564 WP_000455299.1.76761 WP_000455299.1.76972 WP_000455299.1.77 WP_000455299.1.77037 WP_000455299.1.7706 WP_000455299.1.77318 WP_000455299.1.77568 WP_000455299.1.77585 WP_000455299.1.77610 WP_000455299.1.77780 WP_000455299.1.78068 WP_000455299.1.78147 WP_000455299.1.78241 WP_000455299.1.78312 WP_000455299.1.78349 WP_000455299.1.78422 WP_000455299.1.78454 WP_000455299.1.78967 WP_000455299.1.79040 WP_000455299.1.79073 WP_000455299.1.79079 WP_000455299.1.79104 WP_000455299.1.7950 WP_000455299.1.79527 WP_000455299.1.79555 WP_000455299.1.79557 WP_000455299.1.79786 WP_000455299.1.79830 WP_000455299.1.79835 WP_000455299.1.80019 WP_000455299.1.80049 WP_000455299.1.80070 WP_000455299.1.80349 WP_000455299.1.80457 WP_000455299.1.80501 WP_000455299.1.80550 WP_000455299.1.81292 WP_000455299.1.81360 WP_000455299.1.81375 WP_000455299.1.81534 WP_000455299.1.82085 WP_000455299.1.82297 WP_000455299.1.82342 WP_000455299.1.82407 WP_000455299.1.82827 WP_000455299.1.82969 WP_000455299.1.82985 WP_000455299.1.83067 WP_000455299.1.83123 WP_000455299.1.83136 WP_000455299.1.83281 WP_000455299.1.83577 WP_000455299.1.83587 WP_000455299.1.83726 WP_000455299.1.83789 WP_000455299.1.83790 WP_000455299.1.84052 WP_000455299.1.84213 WP_000455299.1.84305 WP_000455299.1.84444 WP_000455299.1.84785 WP_000455299.1.85093 WP_000455299.1.8510 WP_000455299.1.85222 WP_000455299.1.85258 WP_000455299.1.85826 WP_000455299.1.8590 WP_000455299.1.85907 WP_000455299.1.85947 WP_000455299.1.86118 WP_000455299.1.86403 WP_000455299.1.86503 WP_000455299.1.86685 WP_000455299.1.86722 WP_000455299.1.86751 WP_000455299.1.86866 WP_000455299.1.86996 WP_000455299.1.87077 WP_000455299.1.87248 WP_000455299.1.87664 WP_000455299.1.87863 WP_000455299.1.87946 WP_000455299.1.87961 WP_000455299.1.87993 WP_000455299.1.88225 WP_000455299.1.88232 WP_000455299.1.88433 WP_000455299.1.88699 WP_000455299.1.88722 WP_000455299.1.88939 WP_000455299.1.89034 WP_000455299.1.89059 WP_000455299.1.89224 WP_000455299.1.89254 WP_000455299.1.89369 WP_000455299.1.89620 WP_000455299.1.89806 WP_000455299.1.90059 WP_000455299.1.90113 WP_000455299.1.90119 WP_000455299.1.90124 WP_000455299.1.90197 WP_000455299.1.90678 WP_000455299.1.91052 WP_000455299.1.91058 WP_000455299.1.91119 WP_000455299.1.91154 WP_000455299.1.91388 WP_000455299.1.91468 WP_000455299.1.91481 WP_000455299.1.91650 WP_000455299.1.91878 WP_000455299.1.91972 WP_000455299.1.92015 WP_000455299.1.92027 WP_000455299.1.92121 WP_000455299.1.92248 WP_000455299.1.92271 WP_000455299.1.92386 WP_000455299.1.92491 WP_000455299.1.92563 WP_000455299.1.93075 WP_000455299.1.93108 WP_000455299.1.93238 WP_000455299.1.93474 WP_000455299.1.93475 WP_000455299.1.93548 WP_000455299.1.93592 WP_000455299.1.93785 WP_000455299.1.93910 WP_000455299.1.94139 WP_000455299.1.94148 WP_000455299.1.943 WP_000455299.1.94330 WP_000455299.1.94395 WP_000455299.1.94476 WP_000455299.1.94526 WP_000455299.1.94595 WP_000455299.1.94643 WP_000455299.1.94651 WP_000455299.1.94778 WP_000455299.1.94883 WP_000455299.1.95058 WP_000455299.1.95106 WP_000455299.1.95153 WP_000455299.1.95177 WP_000455299.1.95276 WP_000455299.1.9528 WP_000455299.1.95321 WP_000455299.1.95528 WP_000455299.1.95531 WP_000455299.1.95688 WP_000455299.1.95736 WP_000455299.1.95853 WP_000455299.1.95998 WP_000455299.1.96049 WP_000455299.1.96111 WP_000455299.1.96181 WP_000455299.1.9621 WP_000455299.1.96336 WP_000455299.1.96436 WP_000455299.1.96595 WP_000455299.1.966 WP_000455299.1.9681 WP_000455299.1.96961 WP_000455299.1.97308 WP_000455299.1.97657 WP_000455299.1.97829 WP_000455299.1.97931 WP_000455299.1.98286 WP_000455299.1.98504 WP_000455299.1.98679 WP_000455299.1.98732 WP_000455299.1.98740 WP_000455299.1.98759 WP_000455299.1.98771 WP_000455299.1.98781 WP_000455299.1.99342 WP_000455299.1.99593 WP_000455299.1.99606 WP_000455299.1.99640 WP_000455299.1.9969 WP_000455299.1.997 WP_000455299.1.99781 WP_000455299.1.99787 WP_000455299.1.99793 WP_000455299.1.99879 WP_000455299.1.99980 171101.spr1568 373153.SPD_1534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]