SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 176279.SERP0841 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  176279.SERP0841
Domain Number 1 Region: 8-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.04e-49
Family Ribonuclease PH domain 1-like 0.0000198
Further Details:      
 
Domain Number 2 Region: 297-491
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-48
Family Ribonuclease PH domain 1-like 0.000021
Further Details:      
 
Domain Number 3 Region: 454-552
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-29
Family Ribonuclease PH domain 2-like 0.0000828
Further Details:      
 
Domain Number 4 Region: 145-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.75e-26
Family Ribonuclease PH domain 2-like 0.0029
Further Details:      
 
Domain Number 5 Region: 559-644
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.88e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Domain Number 6 Region: 624-698
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.65e-19
Family Cold shock DNA-binding domain-like 0.00076
Further Details:      
 
Domain Number 7 Region: 239-324
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.46e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 176279.SERP0841
Sequence length 701
Comment (Staphylococcus epidermidis RP62A)
Sequence
MSQEKKVFKTEWAGRSLTIETGQLAKQANGAVLVRYGDTVVLSTATASKEPRDGDFFPLT
VNYEEKMYAAGKIPGGFKKREGRPGDEATLTARLIDRPIRPLFPKGYRHDVQIMNIVLSA
DPDCSPEMAAMIGSSMALSVSDIPFQGPIAGVNVGYIDGKYVINPSVADKEISRLDLEVA
GHKDAVNMVEAGASEITESEMLEAIFFGHEEIKRLVAFQQEIIDHIQPIKQEFVPVERDE
DLVEKVKSLTEDKGLKDTVLTFDKQQRDENLDALKEEVVGHFLDEEDPENETLVKEVYAI
LNDLIKEEVRRLIADEKIRPDGRKVDEIRPLESEVGLLPRAHGSGLFTRGQTQALSVLTL
GALGDYQLIDGLGPEVEKRFMHHYNFPNFSVGETGPVRAPGRREIGHGALGERALRYIIP
DTQDFPYTIRIVSEVLESNGSSSQASICGSTLALMDAGVPIKAPVAGIAMGLVTRDDSYT
ILTDIQGMEDALGDMDFKVAGTKDGITAIQMDIKIDGLTREVIEEALEQARQGRLAIMDH
MLHTIEQPREELSAYAPKVVTMSINPDKIRDVIGPGGKKINEIIDETGVKLDIEQDGTIF
IGAVDQAMINRAKEIIEDITREAEVGQVYHAKVKRIEKYGAFVELFPGKDALLHISQISQ
ERINKVEDVLKIGDTIEVKITEIDKQGRVNASHKVLEQSKN
Download sequence
Identical sequences A0A111AC96 A0A2G7HU79 D4FJI2 Q5HPR7 Q8CST1
gi|57866764|ref|YP_188423.1| NP_764506.1.96214 WP_001832554.1.100050 WP_001832554.1.10021 WP_001832554.1.100433 WP_001832554.1.100549 WP_001832554.1.100800 WP_001832554.1.101292 WP_001832554.1.101732 WP_001832554.1.10200 WP_001832554.1.10516 WP_001832554.1.1066 WP_001832554.1.10880 WP_001832554.1.11097 WP_001832554.1.11264 WP_001832554.1.1172 WP_001832554.1.11988 WP_001832554.1.12195 WP_001832554.1.12254 WP_001832554.1.12399 WP_001832554.1.12601 WP_001832554.1.12633 WP_001832554.1.13713 WP_001832554.1.13993 WP_001832554.1.1487 WP_001832554.1.14999 WP_001832554.1.15050 WP_001832554.1.15264 WP_001832554.1.15608 WP_001832554.1.15634 WP_001832554.1.15776 WP_001832554.1.15796 WP_001832554.1.15975 WP_001832554.1.16031 WP_001832554.1.16425 WP_001832554.1.16888 WP_001832554.1.1734 WP_001832554.1.17536 WP_001832554.1.17589 WP_001832554.1.1780 WP_001832554.1.17932 WP_001832554.1.18322 WP_001832554.1.18738 WP_001832554.1.18820 WP_001832554.1.18924 WP_001832554.1.19169 WP_001832554.1.19525 WP_001832554.1.19634 WP_001832554.1.19747 WP_001832554.1.20222 WP_001832554.1.20605 WP_001832554.1.20829 WP_001832554.1.2143 WP_001832554.1.22029 WP_001832554.1.2266 WP_001832554.1.22744 WP_001832554.1.2308 WP_001832554.1.23129 WP_001832554.1.23748 WP_001832554.1.23933 WP_001832554.1.2398 WP_001832554.1.23999 WP_001832554.1.24537 WP_001832554.1.25104 WP_001832554.1.2587 WP_001832554.1.26079 WP_001832554.1.26136 WP_001832554.1.26763 WP_001832554.1.26887 WP_001832554.1.27014 WP_001832554.1.27020 WP_001832554.1.27021 WP_001832554.1.27243 WP_001832554.1.27273 WP_001832554.1.27634 WP_001832554.1.2771 WP_001832554.1.27842 WP_001832554.1.27875 WP_001832554.1.28189 WP_001832554.1.28279 WP_001832554.1.29015 WP_001832554.1.29043 WP_001832554.1.29412 WP_001832554.1.29900 WP_001832554.1.30044 WP_001832554.1.30590 WP_001832554.1.31449 WP_001832554.1.31487 WP_001832554.1.31837 WP_001832554.1.32007 WP_001832554.1.32060 WP_001832554.1.32657 WP_001832554.1.33089 WP_001832554.1.33508 WP_001832554.1.33701 WP_001832554.1.34082 WP_001832554.1.34374 WP_001832554.1.34705 WP_001832554.1.34758 WP_001832554.1.35206 WP_001832554.1.35778 WP_001832554.1.36104 WP_001832554.1.36293 WP_001832554.1.36528 WP_001832554.1.36840 WP_001832554.1.3698 WP_001832554.1.3735 WP_001832554.1.37506 WP_001832554.1.37572 WP_001832554.1.37668 WP_001832554.1.37755 WP_001832554.1.38090 WP_001832554.1.38123 WP_001832554.1.38364 WP_001832554.1.38568 WP_001832554.1.3910 WP_001832554.1.39158 WP_001832554.1.39520 WP_001832554.1.40006 WP_001832554.1.40194 WP_001832554.1.40309 WP_001832554.1.40408 WP_001832554.1.40535 WP_001832554.1.40661 WP_001832554.1.40934 WP_001832554.1.41570 WP_001832554.1.4163 WP_001832554.1.41640 WP_001832554.1.42083 WP_001832554.1.42133 WP_001832554.1.42501 WP_001832554.1.42781 WP_001832554.1.430 WP_001832554.1.43129 WP_001832554.1.43309 WP_001832554.1.43463 WP_001832554.1.43835 WP_001832554.1.44120 WP_001832554.1.44564 WP_001832554.1.44582 WP_001832554.1.44772 WP_001832554.1.45071 WP_001832554.1.45275 WP_001832554.1.45314 WP_001832554.1.45384 WP_001832554.1.45401 WP_001832554.1.45409 WP_001832554.1.45515 WP_001832554.1.45625 WP_001832554.1.45766 WP_001832554.1.45985 WP_001832554.1.46159 WP_001832554.1.46517 WP_001832554.1.46580 WP_001832554.1.46639 WP_001832554.1.4677 WP_001832554.1.46800 WP_001832554.1.47347 WP_001832554.1.47465 WP_001832554.1.4806 WP_001832554.1.48269 WP_001832554.1.48665 WP_001832554.1.48672 WP_001832554.1.50102 WP_001832554.1.50141 WP_001832554.1.50545 WP_001832554.1.51168 WP_001832554.1.5131 WP_001832554.1.51353 WP_001832554.1.51852 WP_001832554.1.52629 WP_001832554.1.53182 WP_001832554.1.54233 WP_001832554.1.54624 WP_001832554.1.55205 WP_001832554.1.55323 WP_001832554.1.55394 WP_001832554.1.5653 WP_001832554.1.56880 WP_001832554.1.57396 WP_001832554.1.57676 WP_001832554.1.57912 WP_001832554.1.57980 WP_001832554.1.58205 WP_001832554.1.58920 WP_001832554.1.59220 WP_001832554.1.59429 WP_001832554.1.59612 WP_001832554.1.59696 WP_001832554.1.60263 WP_001832554.1.604 WP_001832554.1.60471 WP_001832554.1.60968 WP_001832554.1.61134 WP_001832554.1.61355 WP_001832554.1.61490 WP_001832554.1.62056 WP_001832554.1.62209 WP_001832554.1.62552 WP_001832554.1.63199 WP_001832554.1.63339 WP_001832554.1.63714 WP_001832554.1.64636 WP_001832554.1.64836 WP_001832554.1.65535 WP_001832554.1.65731 WP_001832554.1.65823 WP_001832554.1.66623 WP_001832554.1.66725 WP_001832554.1.67105 WP_001832554.1.67262 WP_001832554.1.67413 WP_001832554.1.67493 WP_001832554.1.68211 WP_001832554.1.68456 WP_001832554.1.68665 WP_001832554.1.687 WP_001832554.1.69187 WP_001832554.1.69281 WP_001832554.1.69584 WP_001832554.1.69585 WP_001832554.1.69743 WP_001832554.1.70385 WP_001832554.1.70534 WP_001832554.1.70703 WP_001832554.1.70714 WP_001832554.1.71072 WP_001832554.1.71096 WP_001832554.1.7127 WP_001832554.1.72059 WP_001832554.1.72202 WP_001832554.1.72358 WP_001832554.1.72549 WP_001832554.1.7287 WP_001832554.1.72908 WP_001832554.1.72948 WP_001832554.1.73003 WP_001832554.1.73271 WP_001832554.1.7393 WP_001832554.1.74694 WP_001832554.1.75068 WP_001832554.1.75166 WP_001832554.1.75383 WP_001832554.1.75578 WP_001832554.1.75757 WP_001832554.1.76151 WP_001832554.1.76766 WP_001832554.1.7796 WP_001832554.1.78204 WP_001832554.1.78266 WP_001832554.1.78514 WP_001832554.1.78749 WP_001832554.1.79009 WP_001832554.1.79087 WP_001832554.1.79415 WP_001832554.1.79632 WP_001832554.1.79856 WP_001832554.1.80118 WP_001832554.1.80285 WP_001832554.1.80313 WP_001832554.1.80534 WP_001832554.1.80584 WP_001832554.1.81223 WP_001832554.1.81614 WP_001832554.1.81804 WP_001832554.1.81818 WP_001832554.1.82021 WP_001832554.1.82163 WP_001832554.1.82199 WP_001832554.1.82273 WP_001832554.1.8237 WP_001832554.1.82807 WP_001832554.1.83976 WP_001832554.1.84232 WP_001832554.1.84248 WP_001832554.1.8443 WP_001832554.1.84545 WP_001832554.1.85164 WP_001832554.1.85372 WP_001832554.1.85735 WP_001832554.1.85851 WP_001832554.1.86219 WP_001832554.1.86391 WP_001832554.1.87036 WP_001832554.1.87531 WP_001832554.1.87968 WP_001832554.1.88153 WP_001832554.1.88436 WP_001832554.1.8850 WP_001832554.1.88657 WP_001832554.1.88681 WP_001832554.1.8890 WP_001832554.1.89058 WP_001832554.1.89239 WP_001832554.1.89313 WP_001832554.1.89535 WP_001832554.1.89842 WP_001832554.1.89877 WP_001832554.1.90573 WP_001832554.1.910 WP_001832554.1.91028 WP_001832554.1.91726 WP_001832554.1.91956 WP_001832554.1.92296 WP_001832554.1.92313 WP_001832554.1.92414 WP_001832554.1.92919 WP_001832554.1.92977 WP_001832554.1.93985 WP_001832554.1.94055 WP_001832554.1.94358 WP_001832554.1.95367 WP_001832554.1.95589 WP_001832554.1.95903 WP_001832554.1.96333 WP_001832554.1.96627 WP_001832554.1.96673 WP_001832554.1.96799 WP_001832554.1.96825 WP_001832554.1.97286 WP_001832554.1.97364 WP_001832554.1.9749 WP_001832554.1.97896 WP_001832554.1.98568 WP_001832554.1.98813 WP_001832554.1.98959 WP_001832554.1.99474 WP_001832554.1.99601 176279.SERP0841 176280.SE0951 gi|27467869|ref|NP_764506.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]