SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 176279.SERP1207 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  176279.SERP1207
Domain Number 1 Region: 72-146
Classification Level Classification E-value
Superfamily ACT-like 0.00000000113
Family Aspartokinase allosteric domain-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 176279.SERP1207
Sequence length 151
Comment (Staphylococcus epidermidis RP62A)
Sequence
MDNKDNRKFYLIREDVLPESVIKTLKVKDALKNNSNLSIYDAVKQFNLSRSAFYKYRETI
FPVDEKILDQREFTLILYVNDIVGMLAQVLNAISQLQLSVLTIHQSVPIEDKATITLSLN
ARNSNLSIDEVIESLREINHVTKVDLISMTM
Download sequence
Identical sequences A0A0Y1Z6U5 Q5HNQ8 Q8CNZ8
gi|57867154|ref|YP_188782.1| 176279.SERP1207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]