SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 176280.SE0964 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  176280.SE0964
Domain Number 1 Region: 319-469
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.48e-29
Family HD domain 0.014
Further Details:      
 
Domain Number 2 Region: 206-303
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.6e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 176280.SE0964
Sequence length 519
Comment (Staphylococcus epidermidis ATCC 12228)
Sequence
MNLLSLLLILLGIILGVVVGYIVARNLLHQKQVQARQTADDIVSYANKEADNIKKEKLLE
AKEENQILKEQAENELRERRGELQRQETRLLQKEENLDRKSDLLDKKDEILEQKESKLEE
RQQQVDAKESSVQTLIMKHEQELERISGLTQEEAVKEQLQRVEEELSQDIAILVKEKEKE
AKEKVDKTAKELLATTVQRLAAEHTTESTVSVVNLPNDEMKGRIIGREGRNIRTLETLTG
IDLIIDDTPEAVILSGFDPIRREIARTALVNLVSDGRIHPGRIEDMVEKARKEVDDIIRD
AGEQATFEINVHNMHPDLVKILGRLNYRTSYGQNVLKHSIEVAHLSGMLAAELGEDVTLA
KRAGLLHDVGKAIDHEVEGSHVEIGVELAKKYNENNIIINAIHSHHGDVEPTSIISILVA
AADALSAARPGARKETLENYIRRLERLETLSESYDGVEKAFAIQAGREIRVVVSPEEIDD
LKSYRLARDIKNQIEEELQYPGHIKVTVVRETRAIEYAK
Download sequence
Identical sequences A0A0E1VD76 A0A0E2MX41 A0A111ACA0 A0A1J4H904 A0A1U3UKF0 A0A2G7HU44 D4FJH0 Q5HPQ5 Q8CSS7 W1VWL7
gi|27467882|ref|NP_764519.1| NP_764519.1.96214 WP_001829512.1.100050 WP_001829512.1.100433 WP_001829512.1.100549 WP_001829512.1.100800 WP_001829512.1.101221 WP_001829512.1.101292 WP_001829512.1.101434 WP_001829512.1.101732 WP_001829512.1.10200 WP_001829512.1.10433 WP_001829512.1.10516 WP_001829512.1.1064 WP_001829512.1.1066 WP_001829512.1.10880 WP_001829512.1.11039 WP_001829512.1.11097 WP_001829512.1.11264 WP_001829512.1.11988 WP_001829512.1.12195 WP_001829512.1.12254 WP_001829512.1.12601 WP_001829512.1.12633 WP_001829512.1.12940 WP_001829512.1.13046 WP_001829512.1.13547 WP_001829512.1.13713 WP_001829512.1.13993 WP_001829512.1.1487 WP_001829512.1.14999 WP_001829512.1.15050 WP_001829512.1.15264 WP_001829512.1.15634 WP_001829512.1.15742 WP_001829512.1.15796 WP_001829512.1.15840 WP_001829512.1.15975 WP_001829512.1.16425 WP_001829512.1.16888 WP_001829512.1.1734 WP_001829512.1.17536 WP_001829512.1.17589 WP_001829512.1.18322 WP_001829512.1.18738 WP_001829512.1.19169 WP_001829512.1.19525 WP_001829512.1.19634 WP_001829512.1.20222 WP_001829512.1.20605 WP_001829512.1.2088 WP_001829512.1.21138 WP_001829512.1.2143 WP_001829512.1.22029 WP_001829512.1.2266 WP_001829512.1.22744 WP_001829512.1.2308 WP_001829512.1.23129 WP_001829512.1.23748 WP_001829512.1.23933 WP_001829512.1.2398 WP_001829512.1.23999 WP_001829512.1.24406 WP_001829512.1.24864 WP_001829512.1.25104 WP_001829512.1.25359 WP_001829512.1.26079 WP_001829512.1.26136 WP_001829512.1.26728 WP_001829512.1.26887 WP_001829512.1.27014 WP_001829512.1.27020 WP_001829512.1.27021 WP_001829512.1.27273 WP_001829512.1.27481 WP_001829512.1.27842 WP_001829512.1.27875 WP_001829512.1.28189 WP_001829512.1.28279 WP_001829512.1.29015 WP_001829512.1.29043 WP_001829512.1.29900 WP_001829512.1.30044 WP_001829512.1.30228 WP_001829512.1.30361 WP_001829512.1.30590 WP_001829512.1.31449 WP_001829512.1.31487 WP_001829512.1.31837 WP_001829512.1.32007 WP_001829512.1.32657 WP_001829512.1.33011 WP_001829512.1.33089 WP_001829512.1.33508 WP_001829512.1.33701 WP_001829512.1.34082 WP_001829512.1.34705 WP_001829512.1.34758 WP_001829512.1.35778 WP_001829512.1.36104 WP_001829512.1.36528 WP_001829512.1.3698 WP_001829512.1.37086 WP_001829512.1.37090 WP_001829512.1.3735 WP_001829512.1.37506 WP_001829512.1.37572 WP_001829512.1.37755 WP_001829512.1.38090 WP_001829512.1.38123 WP_001829512.1.38296 WP_001829512.1.38364 WP_001829512.1.38568 WP_001829512.1.39158 WP_001829512.1.39993 WP_001829512.1.40006 WP_001829512.1.40194 WP_001829512.1.40309 WP_001829512.1.40535 WP_001829512.1.40661 WP_001829512.1.40934 WP_001829512.1.40938 WP_001829512.1.4134 WP_001829512.1.41570 WP_001829512.1.4163 WP_001829512.1.41640 WP_001829512.1.42083 WP_001829512.1.42133 WP_001829512.1.42501 WP_001829512.1.43129 WP_001829512.1.43309 WP_001829512.1.43835 WP_001829512.1.44114 WP_001829512.1.44120 WP_001829512.1.44564 WP_001829512.1.44582 WP_001829512.1.44772 WP_001829512.1.45071 WP_001829512.1.45275 WP_001829512.1.45314 WP_001829512.1.45384 WP_001829512.1.45401 WP_001829512.1.45409 WP_001829512.1.45515 WP_001829512.1.45625 WP_001829512.1.45748 WP_001829512.1.45766 WP_001829512.1.45985 WP_001829512.1.46052 WP_001829512.1.46159 WP_001829512.1.46517 WP_001829512.1.46580 WP_001829512.1.46639 WP_001829512.1.4677 WP_001829512.1.46800 WP_001829512.1.47347 WP_001829512.1.47465 WP_001829512.1.4806 WP_001829512.1.48269 WP_001829512.1.48318 WP_001829512.1.48672 WP_001829512.1.49813 WP_001829512.1.50086 WP_001829512.1.50102 WP_001829512.1.50268 WP_001829512.1.50545 WP_001829512.1.51168 WP_001829512.1.51353 WP_001829512.1.51852 WP_001829512.1.52404 WP_001829512.1.52629 WP_001829512.1.55205 WP_001829512.1.55394 WP_001829512.1.55912 WP_001829512.1.5653 WP_001829512.1.56880 WP_001829512.1.57676 WP_001829512.1.57912 WP_001829512.1.58205 WP_001829512.1.58920 WP_001829512.1.59220 WP_001829512.1.59429 WP_001829512.1.59612 WP_001829512.1.59696 WP_001829512.1.60263 WP_001829512.1.604 WP_001829512.1.60471 WP_001829512.1.60968 WP_001829512.1.61134 WP_001829512.1.61355 WP_001829512.1.61490 WP_001829512.1.62056 WP_001829512.1.62068 WP_001829512.1.62700 WP_001829512.1.63199 WP_001829512.1.63339 WP_001829512.1.63535 WP_001829512.1.63714 WP_001829512.1.63858 WP_001829512.1.63865 WP_001829512.1.64580 WP_001829512.1.64636 WP_001829512.1.64836 WP_001829512.1.65535 WP_001829512.1.65731 WP_001829512.1.65823 WP_001829512.1.666 WP_001829512.1.66623 WP_001829512.1.66648 WP_001829512.1.66851 WP_001829512.1.67262 WP_001829512.1.67413 WP_001829512.1.67493 WP_001829512.1.68211 WP_001829512.1.68456 WP_001829512.1.68665 WP_001829512.1.687 WP_001829512.1.68882 WP_001829512.1.69187 WP_001829512.1.69584 WP_001829512.1.69585 WP_001829512.1.70534 WP_001829512.1.70560 WP_001829512.1.70703 WP_001829512.1.70714 WP_001829512.1.70755 WP_001829512.1.71072 WP_001829512.1.71096 WP_001829512.1.72059 WP_001829512.1.72202 WP_001829512.1.72206 WP_001829512.1.72358 WP_001829512.1.72549 WP_001829512.1.72672 WP_001829512.1.7287 WP_001829512.1.72908 WP_001829512.1.73003 WP_001829512.1.73271 WP_001829512.1.7393 WP_001829512.1.74694 WP_001829512.1.74736 WP_001829512.1.75166 WP_001829512.1.75383 WP_001829512.1.75578 WP_001829512.1.75757 WP_001829512.1.7577 WP_001829512.1.7614 WP_001829512.1.76151 WP_001829512.1.76766 WP_001829512.1.77441 WP_001829512.1.7796 WP_001829512.1.78204 WP_001829512.1.78266 WP_001829512.1.78514 WP_001829512.1.78749 WP_001829512.1.79009 WP_001829512.1.79087 WP_001829512.1.79415 WP_001829512.1.79440 WP_001829512.1.79632 WP_001829512.1.79856 WP_001829512.1.80285 WP_001829512.1.80311 WP_001829512.1.80313 WP_001829512.1.80534 WP_001829512.1.80584 WP_001829512.1.81223 WP_001829512.1.81326 WP_001829512.1.81614 WP_001829512.1.81685 WP_001829512.1.81804 WP_001829512.1.81818 WP_001829512.1.82021 WP_001829512.1.82163 WP_001829512.1.82273 WP_001829512.1.82303 WP_001829512.1.8237 WP_001829512.1.83904 WP_001829512.1.83976 WP_001829512.1.84232 WP_001829512.1.84358 WP_001829512.1.8443 WP_001829512.1.84545 WP_001829512.1.85164 WP_001829512.1.85372 WP_001829512.1.85735 WP_001829512.1.85851 WP_001829512.1.86219 WP_001829512.1.86391 WP_001829512.1.87036 WP_001829512.1.88153 WP_001829512.1.88436 WP_001829512.1.8850 WP_001829512.1.88657 WP_001829512.1.88681 WP_001829512.1.8890 WP_001829512.1.89058 WP_001829512.1.89239 WP_001829512.1.89313 WP_001829512.1.89535 WP_001829512.1.89842 WP_001829512.1.89877 WP_001829512.1.90206 WP_001829512.1.90286 WP_001829512.1.910 WP_001829512.1.91028 WP_001829512.1.91726 WP_001829512.1.92120 WP_001829512.1.92296 WP_001829512.1.92313 WP_001829512.1.92977 WP_001829512.1.93985 WP_001829512.1.94358 WP_001829512.1.94891 WP_001829512.1.95367 WP_001829512.1.95589 WP_001829512.1.95903 WP_001829512.1.96333 WP_001829512.1.96627 WP_001829512.1.96673 WP_001829512.1.96825 WP_001829512.1.97364 WP_001829512.1.97447 WP_001829512.1.9749 WP_001829512.1.97896 WP_001829512.1.98025 WP_001829512.1.98274 WP_001829512.1.98568 WP_001829512.1.98959 WP_001829512.1.99601 176279.SERP0853 176280.SE0964 SeR107 gi|57866791|ref|YP_188435.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]