SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 176299.Atu0022 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  176299.Atu0022
Domain Number 1 Region: 4-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.95e-39
Family Thioltransferase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 176299.Atu0022
Sequence length 106
Comment (Agrobacterium tumefaciens C58 Cereon)
Sequence
MATVKVDAANFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEISSELAGKVKVAKLNID
ENPELAAQFGVRSIPTLAIFKGGEVADIKVGAAPKTALSAWISSAA
Download sequence
Identical sequences A0A083ZHQ5 A0A1G8YZ73 A0A1S7Q4X1 F5J6U0 Q7D2B9
176299.Atu0022 gi|159184127|ref|NP_353062.2| NP_353062.2.86381 WP_006311093.1.11033 WP_006311093.1.24142 WP_006311093.1.51814 WP_006311093.1.57042 WP_006311093.1.66048 WP_006311093.1.84136 WP_006311093.1.9015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]